NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS53295.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53295.1 Public Homo sapiens 1 SMIM12 24 110 108 CCDS HistoryNCBI Gene:113444Re-query CCDS DB by CCDS ID:53295.1See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53295.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000417239.1 ENSP00000428541.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000417239.1Link to Ensembl Protein Viewer:ENSP00000428541.1Re-query CCDS DB by Nucleotide ID:ENST00000417239Re-query CCDS DB by Protein ID:ENSP00000428541
Original member Current member EBI ENST00000521580.3 ENSP00000428585.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000521580.3Link to Ensembl Protein Viewer:ENSP00000428585.1Re-query CCDS DB by Nucleotide ID:ENST00000521580Re-query CCDS DB by Protein ID:ENSP00000428585
Original member Current member EBI ENST00000423898.1 ENSP00000428984.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000423898.1Link to Ensembl Protein Viewer:ENSP00000428984.1Re-query CCDS DB by Nucleotide ID:ENST00000423898Re-query CCDS DB by Protein ID:ENSP00000428984
Original member Current member EBI ENST00000456842.1 ENSP00000430198.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000456842.1Link to Ensembl Protein Viewer:ENSP00000430198.1Re-query CCDS DB by Nucleotide ID:ENST00000456842Re-query CCDS DB by Protein ID:ENSP00000430198
Original member Current member EBI ENST00000446026.1 ENSP00000430285.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000446026.1Link to Ensembl Protein Viewer:ENSP00000430285.1Re-query CCDS DB by Nucleotide ID:ENST00000446026Re-query CCDS DB by Protein ID:ENSP00000430285
Original member Current member NCBI NM_001164824.2 NP_001158296.1 Accepted alive Link to Nucleotide Sequence:NM_001164824.2Link to Protein Sequence:NP_001158296.1Re-query CCDS DB by Nucleotide ID:NM_001164824Re-query CCDS DB by Protein ID:NP_001158296Link to BLAST:NP_001158296.1
Original member Current member NCBI NM_001164825.2 NP_001158297.1 Accepted alive Link to Nucleotide Sequence:NM_001164825.2Link to Protein Sequence:NP_001158297.1Re-query CCDS DB by Nucleotide ID:NM_001164825Re-query CCDS DB by Protein ID:NP_001158297Link to BLAST:NP_001158297.1
Original member Current member NCBI NM_001320261.2 NP_001307190.1 Accepted alive Link to Nucleotide Sequence:NM_001320261.2Link to Protein Sequence:NP_001307190.1Re-query CCDS DB by Nucleotide ID:NM_001320261Re-query CCDS DB by Protein ID:NP_001307190Link to BLAST:NP_001307190.1
Original member Current member NCBI NM_138428.6 NP_612437.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_138428.6Link to Protein Sequence:NP_612437.3Re-query CCDS DB by Nucleotide ID:NM_138428Re-query CCDS DB by Protein ID:NP_612437Link to BLAST:NP_612437.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001158296.1 92 Q96EX1 92 100% 0 0
NP_001158297.1 92 Q96EX1 92 100% 0 0
NP_001307190.1 92 Q96EX1 92 100% 0 0
NP_612437.3 92 Q96EX1 92 100% 0 0

Chromosomal Locations for CCDS 53295.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 34855699 34855977 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (279 nt):
ATGTGGCCTGTGTTTTGGACCGTGGTTCGTACCTATGCTCCTTATGTCACATTCCCTGTTGCCTTCGTGG
TC
GGGGCTGTGGGTTACCACCTGGAATGGTTCATCAGGGGAAAGGACCCCCAGCCCGTGGAGGAGGAAAA
G
AGCATCTCAGAGCGCCGGGAGGATCGCAAGCTGGATGAGCTTCTAGGCAAGGACCACACGCAGGTGGTG
AGC
CTTAAGGACAAGCTAGAATTTGCCCCGAAAGCTGTGCTGAACAGAAACCGCCCAGAGAAGAATTAA


Translation (92 aa):
MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVV
S
LKDKLEFAPKAVLNRNRPEKN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser