NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS35202.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35202.1 Public Homo sapiens X TMSB4X 24 110 108 CCDS HistoryNCBI Gene:7114Re-query CCDS DB by CCDS ID:35202.1Re-query CCDS DB by GeneID:7114See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35202.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000380633.1 ENSP00000370007.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380633.1Link to Ensembl Protein Viewer:ENSP00000370007.1Re-query CCDS DB by Nucleotide ID:ENST00000380633Re-query CCDS DB by Protein ID:ENSP00000370007
Original member Current member EBI ENST00000380635.5 ENSP00000370009.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380635.5Link to Ensembl Protein Viewer:ENSP00000370009.1Re-query CCDS DB by Nucleotide ID:ENST00000380635Re-query CCDS DB by Protein ID:ENSP00000370009
Original member Current member EBI ENST00000380636.1 ENSP00000370010.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380636.1Link to Ensembl Protein Viewer:ENSP00000370010.1Re-query CCDS DB by Nucleotide ID:ENST00000380636Re-query CCDS DB by Protein ID:ENSP00000370010
Original member Current member EBI ENST00000451311.7 ENSP00000414376.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000451311.7Link to Ensembl Protein Viewer:ENSP00000414376.2Re-query CCDS DB by Nucleotide ID:ENST00000451311Re-query CCDS DB by Protein ID:ENSP00000414376
Original member Current member NCBI NM_021109.4 NP_066932.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_021109.4Link to Protein Sequence:NP_066932.1Re-query CCDS DB by Nucleotide ID:NM_021109Re-query CCDS DB by Protein ID:NP_066932Link to BLAST:NP_066932.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_066932.1 44 P62328 44 100% 0 0

Chromosomal Locations for CCDS 35202.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 12976262 12976361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 12976777 12976811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (135 nt):
ATGTCTGACAAACCCGATATGGCTGAGATCGAGAAATTCGATAAGTCGAAACTGAAGAAGACAGAGACGC
AAGAGAAAAATCCACTGCCTTCCAAAGAAACGATTGAACAGGAGAAGCAAGCAGGCGAATCGTAA

Translation (44 aa):
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH