NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7548.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7548.1 Public Homo sapiens 10 ATP5MK 24 110 108 CCDS HistoryNCBI Gene:84833Re-query CCDS DB by CCDS ID:7548.1Re-query CCDS DB by GeneID:84833See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7548.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000309579.7 ENSP00000311245.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309579.7Link to Ensembl Protein Viewer:ENSP00000311245.3Re-query CCDS DB by Nucleotide ID:ENST00000309579Re-query CCDS DB by Protein ID:ENSP00000311245
Original member Current member EBI ENST00000337003.4 ENSP00000337705.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000337003.4Link to Ensembl Protein Viewer:ENSP00000337705.4Re-query CCDS DB by Nucleotide ID:ENST00000337003Re-query CCDS DB by Protein ID:ENSP00000337705
Original member Current member EBI ENST00000369811.5 ENSP00000358826.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369811.5Link to Ensembl Protein Viewer:ENSP00000358826.1Re-query CCDS DB by Nucleotide ID:ENST00000369811Re-query CCDS DB by Protein ID:ENSP00000358826
Original member Current member EBI ENST00000369815.6 ENSP00000358830.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000369815.6Link to Ensembl Protein Viewer:ENSP00000358830.1Re-query CCDS DB by Nucleotide ID:ENST00000369815Re-query CCDS DB by Protein ID:ENSP00000358830
Original member Current member EBI ENST00000369825.6 ENSP00000358840.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369825.6Link to Ensembl Protein Viewer:ENSP00000358840.1Re-query CCDS DB by Nucleotide ID:ENST00000369825Re-query CCDS DB by Protein ID:ENSP00000358840
Original member Current member NCBI NM_001206426.2 NP_001193355.1 Accepted alive Link to Nucleotide Sequence:NM_001206426.2Link to Protein Sequence:NP_001193355.1Re-query CCDS DB by Nucleotide ID:NM_001206426Re-query CCDS DB by Protein ID:NP_001193355Link to BLAST:NP_001193355.1
Original member Current member NCBI NM_001206427.2 NP_001193356.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001206427.2Link to Protein Sequence:NP_001193356.1Re-query CCDS DB by Nucleotide ID:NM_001206427Re-query CCDS DB by Protein ID:NP_001193356Link to BLAST:NP_001193356.1
Original member Current member NCBI NM_032747.4 NP_116136.1 Accepted alive Link to Nucleotide Sequence:NM_032747.4Link to Protein Sequence:NP_116136.1Re-query CCDS DB by Nucleotide ID:NM_032747Re-query CCDS DB by Protein ID:NP_116136Link to BLAST:NP_116136.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001193355.1 58 Q96IX5 58 100% 0 0
NP_001193356.1 58 Q96IX5 58 100% 0 0
NP_116136.1 58 Q96IX5 58 100% 0 0

Chromosomal Locations for CCDS 7548.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 103392194 103392283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103392371 103392457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (177 nt):
ATGGCAGGTCCAGAAAGTGATGCGCAATACCAGTTCACTGGTATTAAAAAATATTTCAACTCTTATACTC
TCACAGGTAGAATGAACTGTGTACTGGCCACATATGGAAGCATTGCATTGATTGTCTTATATTTCAAGTT
AAGGTCCAAAAAAACTCCAGCTGTGAAAGCAACATAA

Translation (58 aa):
MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH