NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS24039.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24039.1 Reviewed, update pending Mus musculus 10 Gng7 23 108 98 CCDS HistoryNCBI Gene:14708Re-query CCDS DB by CCDS ID:24039.1Re-query CCDS DB by GeneID:14708See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 24039.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000092285.9 ENSMUSP00000089936.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092285.9Link to Ensembl Protein Viewer:ENSMUSP00000089936.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000092285Re-query CCDS DB by Protein ID:ENSMUSP00000089936
Original member Current member EBI ENSMUST00000099462.7 ENSMUSP00000097061.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099462.7Link to Ensembl Protein Viewer:ENSMUSP00000097061.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000099462Re-query CCDS DB by Protein ID:ENSMUSP00000097061
Original member NCBI NM_001038655.1 NP_001033744.1 Updated not alive Link to Nucleotide Sequence:NM_001038655.1Link to Protein Sequence:NP_001033744.1Re-query CCDS DB by Nucleotide ID:NM_001038655Re-query CCDS DB by Protein ID:NP_001033744
Current member NCBI NM_001038655.2 NP_001033744.2 Pending alive Link to Nucleotide Sequence:NM_001038655.2Link to Protein Sequence:NP_001033744.2Re-query CCDS DB by Nucleotide ID:NM_001038655Re-query CCDS DB by Protein ID:NP_001033744Link to BLAST:NP_001033744.2
Original member NCBI NM_010319.3 NP_034449.2 Updated not alive Link to Nucleotide Sequence:NM_010319.3Link to Protein Sequence:NP_034449.2Re-query CCDS DB by Nucleotide ID:NM_010319Re-query CCDS DB by Protein ID:NP_034449
Current member NCBI NM_010319.4 NP_034449.3 Pending alive Link to Nucleotide Sequence:NM_010319.4Link to Protein Sequence:NP_034449.3Re-query CCDS DB by Nucleotide ID:NM_010319Re-query CCDS DB by Protein ID:NP_034449Link to BLAST:NP_034449.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001033744.2 68 Q61016 68 100% 0 0
NP_034449.3 68 Q61016 68 100% 0 0

Chromosomal Locations for CCDS 24039.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 80951621 80951746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80952831 80952914 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (210 nt):
ATGATGTCAGGTACTAACAACGTCGCCCAGGCCCGGAAGCTGGTGGAGCAGCTGCGCATTGAAGCTGGGA
TC
GAACGCATCAAGGTCTCCAAGGCCTCGTCAGACCTGATGGGCTACTGTGAGCAACATGCCCGCAACGA
T
CCCTTGCTGGTTGGCGTGCCAGCCTCTGAGAATCCATTCAAAGACAAAAAGCCTTGCATAATTCTCTAG


Translation (69 aa):
MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser