NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS41918.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41918.1 Public Homo sapiens 14 MRPL52 24 110 108 CCDS HistoryNCBI Gene:122704Re-query CCDS DB by CCDS ID:41918.1Re-query CCDS DB by GeneID:122704See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41918.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000555345.5 ENSP00000451081.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555345.5Link to Ensembl Protein Viewer:ENSP00000451081.1Re-query CCDS DB by Nucleotide ID:ENST00000555345Re-query CCDS DB by Protein ID:ENSP00000451081
Original member Current member EBI ENST00000553711.5 ENSP00000451303.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000553711.5Link to Ensembl Protein Viewer:ENSP00000451303.1Re-query CCDS DB by Nucleotide ID:ENST00000553711Re-query CCDS DB by Protein ID:ENSP00000451303
Original member Current member EBI ENST00000556840.5 ENSP00000451481.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000556840.5Link to Ensembl Protein Viewer:ENSP00000451481.1Re-query CCDS DB by Nucleotide ID:ENST00000556840Re-query CCDS DB by Protein ID:ENSP00000451481
Original member Current member NCBI NM_181304.3 NP_851821.1 Accepted alive Link to Nucleotide Sequence:NM_181304.3Link to Protein Sequence:NP_851821.1Re-query CCDS DB by Nucleotide ID:NM_181304Re-query CCDS DB by Protein ID:NP_851821Link to BLAST:NP_851821.1
Original member Current member NCBI NM_181305.3 NP_851822.1 Accepted alive Link to Nucleotide Sequence:NM_181305.3Link to Protein Sequence:NP_851822.1Re-query CCDS DB by Nucleotide ID:NM_181305Re-query CCDS DB by Protein ID:NP_851822Link to BLAST:NP_851822.1
Original member Current member NCBI NM_181306.3 NP_851823.1 Accepted alive Link to Nucleotide Sequence:NM_181306.3Link to Protein Sequence:NP_851823.1Re-query CCDS DB by Nucleotide ID:NM_181306Re-query CCDS DB by Protein ID:NP_851823Link to BLAST:NP_851823.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_851821.1 64 Q86TS9-2 64 100% 0 0
NP_851822.1 64 Q86TS9-2 64 100% 0 0
NP_851823.1 64 Q86TS9-2 64 100% 0 0

Chromosomal Locations for CCDS 41918.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 22833438 22833482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 22834172 22834321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGAAAGGCCAGCTTCGAAGAAAAGCTGAAAGGGAGACGTTTGCAAGACGAGTTGTACTGCTGTCACAGG
AAATGGACGCTGGATTACAAGCATGGCAGCTCAGGCAGCAGAAGTTGCAGGAAGAACAAAGGAAGCAGGA
AAATGCTCTTAAACCCAAAGGGGCTTCACTGAAGAGCCCACTTCCAAGTCAATAA

Translation (64 aa):
MKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH