NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS53880.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53880.1 Public Homo sapiens 13 DAOA 24 110 108 CCDS HistoryNCBI Gene:267012Re-query CCDS DB by CCDS ID:53880.1Re-query CCDS DB by GeneID:267012See the combined annotation on chromosome 13 in Sequence Viewer

Public Note for CCDS 53880.1
This CCDS ID represents the protein described in PMIDs: 12364586 and 14966479. This transcript is supported by AY170469.2. It should be noted this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because it was detected endogenously in PMID: 18544534. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein.

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 53880.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000329625.9 ENSP00000329951.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000329625.9Link to Ensembl Protein Viewer:ENSP00000329951.5Re-query CCDS DB by Nucleotide ID:ENST00000329625Re-query CCDS DB by Protein ID:ENSP00000329951
Original member Current member EBI ENST00000559369.5 ENSP00000453831.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000559369.5Link to Ensembl Protein Viewer:ENSP00000453831.1Re-query CCDS DB by Nucleotide ID:ENST00000559369Re-query CCDS DB by Protein ID:ENSP00000453831
Original member Current member EBI ENST00000600388.5 ENSP00000472260.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000600388.5Link to Ensembl Protein Viewer:ENSP00000472260.1Re-query CCDS DB by Nucleotide ID:ENST00000600388Re-query CCDS DB by Protein ID:ENSP00000472260
Original member Current member NCBI NM_001161814.1 NP_001155286.1 Accepted alive Link to Nucleotide Sequence:NM_001161814.1Link to Protein Sequence:NP_001155286.1Re-query CCDS DB by Nucleotide ID:NM_001161814Re-query CCDS DB by Protein ID:NP_001155286Link to BLAST:NP_001155286.1
Original member Current member NCBI NM_001384646.1 NP_001371575.1 Accepted alive Link to Nucleotide Sequence:NM_001384646.1Link to Protein Sequence:NP_001371575.1Re-query CCDS DB by Nucleotide ID:NM_001384646Re-query CCDS DB by Protein ID:NP_001371575Link to BLAST:NP_001371575.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001155286.1 82 P59103-3 82 100% 0 0
NP_001371575.1 82 P59103-3 82 100% 0 0

Chromosomal Locations for CCDS 53880.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 105472618 105472685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 105489901 105490081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (249 nt):
ATGGCACAGAGGCATTTACAGAGATCATTATGTCCTTGGGTCTCTTACCTTCCTCAGCCCTATGCAGAGC
TTGAAGAAGTAAGCAGCCATGTTGGAAAAGTCTTCATGGCAAGAAACTATGAGTTCCTTGCCTATGAGGC
CTCTAAGGACCGCAGGCAGCCTCTAGAACGAATGTGGACCTGCAACTACAACCAGCAAAAAGACCAGTCA
TGCAACCACAAGGAAATAACTTCTACCAAAGCTGAATGA

Translation (82 aa):
MAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQS
CNHKEITSTKAE


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH