NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS59172.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59172.1 Public Homo sapiens X TMSB15B 24 110 108 CCDS HistoryNCBI Gene:286527Re-query CCDS DB by CCDS ID:59172.1See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59172.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000540220.6 ENSP00000455371.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000540220.6Link to Ensembl Protein Viewer:ENSP00000455371.1Re-query CCDS DB by Nucleotide ID:ENST00000540220Re-query CCDS DB by Protein ID:ENSP00000455371
Original member Current member EBI ENST00000436583.5 ENSP00000455771.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000436583.5Link to Ensembl Protein Viewer:ENSP00000455771.1Re-query CCDS DB by Nucleotide ID:ENST00000436583Re-query CCDS DB by Protein ID:ENSP00000455771
Original member Current member EBI ENST00000419165.5 ENSP00000456121.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419165.5Link to Ensembl Protein Viewer:ENSP00000456121.1Re-query CCDS DB by Nucleotide ID:ENST00000419165Re-query CCDS DB by Protein ID:ENSP00000456121
Original member Current member EBI ENST00000569577.1 ENSP00000457057.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000569577.1Link to Ensembl Protein Viewer:ENSP00000457057.1Re-query CCDS DB by Nucleotide ID:ENST00000569577Re-query CCDS DB by Protein ID:ENSP00000457057
Original member Current member NCBI NM_001350211.2 NP_001337140.1 Accepted alive Link to Nucleotide Sequence:NM_001350211.2Link to Protein Sequence:NP_001337140.1Re-query CCDS DB by Nucleotide ID:NM_001350211Re-query CCDS DB by Protein ID:NP_001337140Link to BLAST:NP_001337140.1
Original member Current member NCBI NM_001350212.2 NP_001337141.1 Accepted alive Link to Nucleotide Sequence:NM_001350212.2Link to Protein Sequence:NP_001337141.1Re-query CCDS DB by Nucleotide ID:NM_001350212Re-query CCDS DB by Protein ID:NP_001337141Link to BLAST:NP_001337141.1
Original member Current member NCBI NM_194324.4 NP_919305.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_194324.4Link to Protein Sequence:NP_919305.2Re-query CCDS DB by Nucleotide ID:NM_194324Re-query CCDS DB by Protein ID:NP_919305Link to BLAST:NP_919305.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001337140.1 45 P0CG35 45 100% 0 0
NP_001337141.1 45 P0CG35 45 100% 0 0
NP_919305.2 45 P0CG35 45 100% 0 0

Chromosomal Locations for CCDS 59172.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 103964523 103964622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 103965539 103965576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (138 nt):
ATGAGTGATAAACCAGACTTGTCGGAAGTGGAGAAGTTTGACAGGTCAAAACTGAAGAAAACTAATACTG
AAGAAAAAAATACTCTTCCCTCAAAGGAAACTATCCAGCAGGAGAAAGAGTGTGTTCAAACATCATAA

Translation (45 aa):
MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH