NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS21657.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21657.1 Public Mus musculus 7 Timm10b 23 108 98 CCDS HistoryNCBI Gene:14356Re-query CCDS DB by CCDS ID:21657.1Re-query CCDS DB by GeneID:14356See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21657.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000058333.9 ENSMUSP00000057061.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058333.9Link to Ensembl Protein Viewer:ENSMUSP00000057061.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000058333Re-query CCDS DB by Protein ID:ENSMUSP00000057061
Original member Current member EBI ENSMUST00000106780.1 ENSMUSP00000102392.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106780.1Link to Ensembl Protein Viewer:ENSMUSP00000102392.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106780Re-query CCDS DB by Protein ID:ENSMUSP00000102392
Original member Current member EBI ENSMUST00000106783.7 ENSMUSP00000102395.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106783.7Link to Ensembl Protein Viewer:ENSMUSP00000102395.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106783Re-query CCDS DB by Protein ID:ENSMUSP00000102395
Original member Current member EBI ENSMUST00000142874.8 ENSMUSP00000147621.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142874.8Link to Ensembl Protein Viewer:ENSMUSP00000147621.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000142874Re-query CCDS DB by Protein ID:ENSMUSP00000147621
Original member Current member EBI ENSMUST00000142363.7 ENSMUSP00000148105.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142363.7Link to Ensembl Protein Viewer:ENSMUSP00000148105.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000142363Re-query CCDS DB by Protein ID:ENSMUSP00000148105
Original member Current member EBI ENSMUST00000211054.1 ENSMUSP00000148176.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000211054.1Link to Ensembl Protein Viewer:ENSMUSP00000148176.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000211054Re-query CCDS DB by Protein ID:ENSMUSP00000148176
Original member Current member NCBI NM_001360055.1 NP_001346984.1 Accepted alive Link to Nucleotide Sequence:NM_001360055.1Link to Protein Sequence:NP_001346984.1Re-query CCDS DB by Nucleotide ID:NM_001360055Re-query CCDS DB by Protein ID:NP_001346984Link to BLAST:NP_001346984.1
Original member Current member NCBI NM_001360056.1 NP_001346985.1 Accepted alive Link to Nucleotide Sequence:NM_001360056.1Link to Protein Sequence:NP_001346985.1Re-query CCDS DB by Nucleotide ID:NM_001360056Re-query CCDS DB by Protein ID:NP_001346985Link to BLAST:NP_001346985.1
Original member Current member NCBI NM_019502.3 NP_062375.1 Accepted alive Link to Nucleotide Sequence:NM_019502.3Link to Protein Sequence:NP_062375.1Re-query CCDS DB by Nucleotide ID:NM_019502Re-query CCDS DB by Protein ID:NP_062375Link to BLAST:NP_062375.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001346984.1 100 Q9WV96 100 100% 0 0
NP_001346985.1 100 Q9WV96 100 100% 0 0
NP_062375.1 100 Q9WV96 100 100% 0 0

Chromosomal Locations for CCDS 21657.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 105640593 105640622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105640762 105640857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 105641028 105641204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (303 nt):
ATGGAGCAGCAGCAGCAGCAACTGAGAAACTTGCGAGACTTCCTGTTGGTCTACAATCGGATGACAGAAC
TG
TGTTTCCAGCGCTGTGTGCCCAGCCTGCACCACCGAGCTCTGGACGCTGAGGAGGAGGCCTGCCTGCA
C
AGCTGTGCTGGGAAACTCATCCATTCTAACCACCGCCTCATGGCCGCTTACGTGCACCTCATGCCCGCC
CTG
GTCCAGCGCCGCATCGCGGACTACGAGGCTGCCTCGGCCGCGCCAGGTATTCCTGCAGAACAGACCA
GA
GACTCGCCATCAGGCAGCTAG


Translation (100 aa):
MEQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPA
L
VQRRIADYEAASAAPGIPAEQTRDSPSGS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser