NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS39706.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39706.1 Public Mus musculus 6 Etfrf1 23 108 98 CCDS HistoryNCBI Gene:67636Re-query CCDS DB by CCDS ID:39706.1Re-query CCDS DB by GeneID:67636See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39706.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000039729.4 ENSMUSP00000039433.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039729.4Link to Ensembl Protein Viewer:ENSMUSP00000039433.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000039729Re-query CCDS DB by Protein ID:ENSMUSP00000039433
Original member Current member EBI ENSMUST00000111719.1 ENSMUSP00000107348.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111719.1Link to Ensembl Protein Viewer:ENSMUSP00000107348.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111719Re-query CCDS DB by Protein ID:ENSMUSP00000107348
Original member Current member EBI ENSMUST00000111721.1 ENSMUSP00000107350.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111721.1Link to Ensembl Protein Viewer:ENSMUSP00000107350.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111721Re-query CCDS DB by Protein ID:ENSMUSP00000107350
Original member Current member EBI ENSMUST00000111723.7 ENSMUSP00000107352.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111723.7Link to Ensembl Protein Viewer:ENSMUSP00000107352.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111723Re-query CCDS DB by Protein ID:ENSMUSP00000107352
Original member Current member EBI ENSMUST00000111724.7 ENSMUSP00000107353.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111724.7Link to Ensembl Protein Viewer:ENSMUSP00000107353.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111724Re-query CCDS DB by Protein ID:ENSMUSP00000107353
Original member Current member EBI ENSMUST00000111725.7 ENSMUSP00000107354.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111725.7Link to Ensembl Protein Viewer:ENSMUSP00000107354.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111725Re-query CCDS DB by Protein ID:ENSMUSP00000107354
Original member Current member EBI ENSMUST00000111726.9 ENSMUSP00000107355.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111726.9Link to Ensembl Protein Viewer:ENSMUSP00000107355.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000111726Re-query CCDS DB by Protein ID:ENSMUSP00000107355
Original member Current member NCBI NM_001163628.1 NP_001157100.1 Accepted alive Link to Nucleotide Sequence:NM_001163628.1Link to Protein Sequence:NP_001157100.1Re-query CCDS DB by Nucleotide ID:NM_001163628Re-query CCDS DB by Protein ID:NP_001157100Link to BLAST:NP_001157100.1
Original member Current member NCBI NM_001362053.1 NP_001348982.1 Accepted alive Link to Nucleotide Sequence:NM_001362053.1Link to Protein Sequence:NP_001348982.1Re-query CCDS DB by Nucleotide ID:NM_001362053Re-query CCDS DB by Protein ID:NP_001348982Link to BLAST:NP_001348982.1
Original member Current member NCBI NM_001362054.1 NP_001348983.1 Accepted alive Link to Nucleotide Sequence:NM_001362054.1Link to Protein Sequence:NP_001348983.1Re-query CCDS DB by Nucleotide ID:NM_001362054Re-query CCDS DB by Protein ID:NP_001348983Link to BLAST:NP_001348983.1
Original member Current member NCBI NM_001362055.1 NP_001348984.1 Accepted alive Link to Nucleotide Sequence:NM_001362055.1Link to Protein Sequence:NP_001348984.1Re-query CCDS DB by Nucleotide ID:NM_001362055Re-query CCDS DB by Protein ID:NP_001348984Link to BLAST:NP_001348984.1
Original member Current member NCBI NM_001362056.1 NP_001348985.1 Accepted alive Link to Nucleotide Sequence:NM_001362056.1Link to Protein Sequence:NP_001348985.1Re-query CCDS DB by Nucleotide ID:NM_001362056Re-query CCDS DB by Protein ID:NP_001348985Link to BLAST:NP_001348985.1
Original member Current member NCBI NM_001362057.1 NP_001348986.1 Accepted alive Link to Nucleotide Sequence:NM_001362057.1Link to Protein Sequence:NP_001348986.1Re-query CCDS DB by Nucleotide ID:NM_001362057Re-query CCDS DB by Protein ID:NP_001348986Link to BLAST:NP_001348986.1
Original member Current member NCBI NM_001362058.1 NP_001348987.1 Accepted alive Link to Nucleotide Sequence:NM_001362058.1Link to Protein Sequence:NP_001348987.1Re-query CCDS DB by Nucleotide ID:NM_001362058Re-query CCDS DB by Protein ID:NP_001348987Link to BLAST:NP_001348987.1
Original member Current member NCBI NM_001362059.1 NP_001348988.1 Accepted alive Link to Nucleotide Sequence:NM_001362059.1Link to Protein Sequence:NP_001348988.1Re-query CCDS DB by Nucleotide ID:NM_001362059Re-query CCDS DB by Protein ID:NP_001348988Link to BLAST:NP_001348988.1
Original member Current member NCBI NM_133688.3 NP_598449.1 Accepted alive Link to Nucleotide Sequence:NM_133688.3Link to Protein Sequence:NP_598449.1Re-query CCDS DB by Nucleotide ID:NM_133688Re-query CCDS DB by Protein ID:NP_598449Link to BLAST:NP_598449.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157100.1 86 Q91V16 86 100% 0 0
NP_001348982.1 86 Q91V16 86 100% 0 0
NP_001348983.1 86 Q91V16 86 100% 0 0
NP_001348984.1 86 Q91V16 86 100% 0 0
NP_001348985.1 86 Q91V16 86 100% 0 0
NP_001348986.1 86 Q91V16 86 100% 0 0
NP_001348987.1 86 Q91V16 86 100% 0 0
NP_001348988.1 86 Q91V16 86 100% 0 0
NP_598449.1 86 Q91V16 86 100% 0 0

Chromosomal Locations for CCDS 39706.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 145215227 145215271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 145215351 145215566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (261 nt):
ATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAATCTGCTGTATCTTGGACGGGACTATC
CA
AAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCC
A
GAGAAGATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTT
AGG
AAATACAGAGCTATGAAGCAACGTTACTATTCAGATACCAAAGTCTGA


Translation (86 aa):
MANSLRGEVLTLYKNLLYLGRDYPKGADYFKRRLKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFL
R
KYRAMKQRYYSDTKV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser