NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, December 17, 2024, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS47317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47317.1 Public Homo sapiens 5 ATOX1 24 110 108 CCDS HistoryNCBI Gene:475Re-query CCDS DB by CCDS ID:47317.1Re-query CCDS DB by GeneID:475See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47317.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000313115.11 ENSP00000316854.6 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000313115.11Link to Ensembl Protein Viewer:ENSP00000316854.6Re-query CCDS DB by Nucleotide ID:ENST00000313115Re-query CCDS DB by Protein ID:ENSP00000316854
Original member Current member EBI ENST00000522710.1 ENSP00000429814.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522710.1Link to Ensembl Protein Viewer:ENSP00000429814.1Re-query CCDS DB by Nucleotide ID:ENST00000522710Re-query CCDS DB by Protein ID:ENSP00000429814
Original member Current member EBI ENST00000524142.5 ENSP00000430598.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000524142.5Link to Ensembl Protein Viewer:ENSP00000430598.1Re-query CCDS DB by Nucleotide ID:ENST00000524142Re-query CCDS DB by Protein ID:ENSP00000430598
Original member Current member NCBI NM_004045.4 NP_004036.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_004045.4Link to Protein Sequence:NP_004036.1Re-query CCDS DB by Nucleotide ID:NM_004045Re-query CCDS DB by Protein ID:NP_004036Link to BLAST:NP_004036.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004036.1 68 O00244 68 100% 0 0

Chromosomal Locations for CCDS 47317.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 151746325 151746449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 151751704 151751779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 151758546 151758551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGCCGAAGCACGAGTTCTCTGTGGACATGACCTGTGGAGGCTGTGCTGAAGCTGTCTCTCGGGTCCTCA
AT
AAGCTTGGAGGAGTTAAGTATGACATTGACCTGCCCAACAAGAAGGTCTGCATTGAATCTGAGCACAG
C
ATGGACACTCTGCTTGCAACCCTGAAGAAAACAGGAAAGACTGTTTCCTACCTTGGCCTTGAGTAG


Translation (68 aa):
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser