NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS75547.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75547.1 Public Homo sapiens 6 MPC1 24 110 108 CCDS HistoryNCBI Gene:51660Re-query CCDS DB by CCDS ID:75547.1Re-query CCDS DB by GeneID:51660See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 75547.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000341756.10 ENSP00000340784.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341756.10Link to Ensembl Protein Viewer:ENSP00000340784.7Re-query CCDS DB by Nucleotide ID:ENST00000341756Re-query CCDS DB by Protein ID:ENSP00000340784
Original member Current member EBI ENST00000621685.4 ENSP00000477853.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621685.4Link to Ensembl Protein Viewer:ENSP00000477853.1Re-query CCDS DB by Nucleotide ID:ENST00000621685Re-query CCDS DB by Protein ID:ENSP00000477853
Original member Current member NCBI NM_001270879.2 NP_001257808.1 Accepted alive Link to Nucleotide Sequence:NM_001270879.2Link to Protein Sequence:NP_001257808.1Re-query CCDS DB by Nucleotide ID:NM_001270879Re-query CCDS DB by Protein ID:NP_001257808Link to BLAST:NP_001257808.1
Original member Current member NCBI NM_001376565.1 NP_001363494.1 Accepted alive Link to Nucleotide Sequence:NM_001376565.1Link to Protein Sequence:NP_001363494.1Re-query CCDS DB by Nucleotide ID:NM_001376565Re-query CCDS DB by Protein ID:NP_001363494Link to BLAST:NP_001363494.1
Original member Current member NCBI NM_001376566.1 NP_001363495.1 Accepted alive Link to Nucleotide Sequence:NM_001376566.1Link to Protein Sequence:NP_001363495.1Re-query CCDS DB by Nucleotide ID:NM_001376566Re-query CCDS DB by Protein ID:NP_001363495Link to BLAST:NP_001363495.1
Original member Current member NCBI NM_001376567.1 NP_001363496.1 Accepted alive Link to Nucleotide Sequence:NM_001376567.1Link to Protein Sequence:NP_001363496.1Re-query CCDS DB by Nucleotide ID:NM_001376567Re-query CCDS DB by Protein ID:NP_001363496Link to BLAST:NP_001363496.1
Original member Current member NCBI NM_001376568.1 NP_001363497.1 Accepted alive Link to Nucleotide Sequence:NM_001376568.1Link to Protein Sequence:NP_001363497.1Re-query CCDS DB by Nucleotide ID:NM_001376568Re-query CCDS DB by Protein ID:NP_001363497Link to BLAST:NP_001363497.1

Chromosomal Locations for CCDS 75547.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 166365429 166365453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 166365974 166366106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 166366795 166366837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (201 nt):
ATGAAAAAGTCTCCAGAGATTATCAGTGGGCGGATGACATTTGCCCTCTGTTGCTATTCTTTGACATTCA
TGAGATTTGCCTACAAGGTACAGCCTCGGAACTGGCTTCTGTTTGCATGCCACGCAACAAATGAAGTAGC
CCAGCTCATCCAGGGAGGGCGGCTTATCAAACACGAGATGACTAAAACGGCATCTGCATAA

Translation (66 aa):
MKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH