NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|62087838|dbj|BAD92366|]
View 

5-hydroxytryptamine (serotonin) receptor 6 variant, partial [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
6-46 5.60e-23

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15054:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 267  Bit Score: 90.63  E-value: 5.60e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   6 QAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15054 227 QAVCDCVSPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 267
 
Name Accession Description Interval E-value
7tmA_5-HT6 cd15054
serotonin receptor subtype 6, member of the class A family of seven-transmembrane G ...
6-46 5.60e-23

serotonin receptor subtype 6, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT6 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT6 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. The 5-HT6 receptors mediates excitatory neurotransmission and are involved in learning and memory; thus they are promising targets for the treatment of cognitive impairment. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320182 [Multi-domain]  Cd Length: 267  Bit Score: 90.63  E-value: 5.60e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   6 QAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15054 227 QAVCDCVSPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 267
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
9-35 3.02e-03

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 36.51  E-value: 3.02e-03
                          10        20
                  ....*....|....*....|....*..
gi 62087838     9 CDCISPGLFDVLTWLGYCNSTMNPIIY 35
Cdd:pfam00001 230 LSRLLDKALSVTLWLAYVNSCLNPIIY 256
 
Name Accession Description Interval E-value
7tmA_5-HT6 cd15054
serotonin receptor subtype 6, member of the class A family of seven-transmembrane G ...
6-46 5.60e-23

serotonin receptor subtype 6, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT6 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT6 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. The 5-HT6 receptors mediates excitatory neurotransmission and are involved in learning and memory; thus they are promising targets for the treatment of cognitive impairment. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320182 [Multi-domain]  Cd Length: 267  Bit Score: 90.63  E-value: 5.60e-23
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   6 QAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15054 227 QAVCDCVSPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 267
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
8-46 5.67e-15

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 69.13  E-value: 5.67e-15
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 62087838   8 VCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd14967 221 PPDCVPPILYAVFFWLGYLNSALNPIIYALFNRDFRRAF 259
7tmA_Ap5-HTB1-like cd15065
serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of ...
1-45 1.28e-12

serotonin receptor subtypes B1 and B2 from Aplysia californica and similar proteins; member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes Aplysia californica serotonin receptors Ap5-HTB1 and Ap5-HTB2, and similar proteins from bilateria including insects, mollusks, annelids, and worms. Ap5-HTB1 is one of the several different receptors for 5-hydroxytryptamine (5HT, serotonin). In Aplysia, serotonin plays important roles in a variety of behavioral and physiological processes mediated by the central nervous system. These include circadian clock, feeding, locomotor movement, cognition and memory, synaptic growth and synaptic plasticity. Both Ap5-HTB1 and Ap5-HTB2 receptors are coupled to G-proteins that stimulate phospholipase C, leading to the activation of phosphoinositide metabolism. Ap5-HTB1 is expressed in the reproductive system, whereas Ap5-HTB2 is expressed in the central nervous system.


Pssm-ID: 320193 [Multi-domain]  Cd Length: 300  Bit Score: 63.14  E-value: 1.28e-12
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 62087838   1 CIPSPQAVCD-CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15065 254 IINIIAAFCKtCIPPKCFKILTWLGYFNSCLNPIIYSIFNSEFRRA 299
7tmA_alpha2_AR cd15059
alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G ...
6-46 4.11e-11

alpha-2 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320187 [Multi-domain]  Cd Length: 261  Bit Score: 58.89  E-value: 4.11e-11
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 62087838   6 QAVCD--CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15059 219 VVVCKtcGVPELLFKFFFWLGYCNSALNPVIYTIFNKDFRRAF 261
7tmA_Octopamine_R cd15063
octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G ...
10-45 1.15e-10

octopamine receptors in invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor for octopamine (OA), which functions as a neurotransmitter, neurohormone, and neuromodulator in invertebrate nervous system. Octopamine (also known as beta, 4-dihydroxyphenethylamine) is an endogenous trace amine that is highly similar to norepinephrine, but lacks a hydroxyl group, and has effects on the adrenergic and dopaminergic nervous systems. Based on the pharmacological and signaling profiles, the octopamine receptors can be classified into at least two groups: OA1 receptors elevate intracellular calcium levels in muscle, whereas OA2 receptors activate adenylate cyclase and increase cAMP production.


Pssm-ID: 320191 [Multi-domain]  Cd Length: 266  Bit Score: 57.51  E-value: 1.15e-10
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15063 230 DCIPPLLFSVFFWLGYCNSALNPCIYALFSRDFRFA 265
7tmA_Dop1R2-like cd15067
dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the ...
16-45 1.97e-10

dopamine 1-like receptor 2 from Drosophila melanogaster and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled dopamine 1-like receptor 2 is expressed in Drosophila heads and it shows significant sequence similarity with vertebrate and invertebrate dopamine receptors. Although the Drosophila Dop1R2 receptor does not cluster into the D1-like structural group, it does show pharmacological properties similar to D1-like receptors. As shown in vertebrate D1-like receptors, agonist stimulation of Dop1R2 activates adenylyl cyclase to increase cAMP levels and also generates a calcium signal through stimulation of phospholipase C.


Pssm-ID: 320195 [Multi-domain]  Cd Length: 262  Bit Score: 56.98  E-value: 1.97e-10
                        10        20        30
                ....*....|....*....|....*....|
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15067 232 LFPLVTWLGYINSGMNPIIYACSSRDFRRA 261
7tmA_TAARs cd15055
trace amine-associated receptors, member of the class A family of seven-transmembrane G ...
12-46 2.70e-10

trace amine-associated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptors (TAARs) are a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320183 [Multi-domain]  Cd Length: 285  Bit Score: 56.79  E-value: 2.70e-10
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15055 251 TPSSVFDVLIWLGYFNSCLNPLIYALFYPWFRKAL 285
7tmA_5-HT2 cd15052
serotonin receptor subtype 2, member of the class A family of seven-transmembrane G ...
9-45 2.93e-10

serotonin receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320180 [Multi-domain]  Cd Length: 262  Bit Score: 56.55  E-value: 2.93e-10
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 62087838   9 CDC-ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15052 224 CNCrISPWLLSVFVWLGYVSSTINPIIYTIFNKTFRRA 261
7tmA_alpha2A_AR cd15322
alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
7-46 5.47e-10

alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320445 [Multi-domain]  Cd Length: 259  Bit Score: 55.72  E-value: 5.47e-10
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   7 AVCDCISPG-LFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15322 219 AVCDCSVPEtLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAF 259
7tmA_5-HT1_5_7 cd15064
serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G ...
4-45 5.68e-10

serotonin receptor subtypes 1, 5 and 7, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes serotonin receptor subtypes 1, 5, and 7 that are activated by the neurotransmitter serotonin. The 5-HT1 and 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family. The 5-HT1 receptor subfamily includes 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as 5-HT2C receptor. The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. The 5-HT7 receptor is coupled to Gs, which positively stimulates adenylate cyclase activity, leading to increased intracellular cAMP formation and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320192 [Multi-domain]  Cd Length: 258  Bit Score: 55.41  E-value: 5.68e-10
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 62087838   4 SPQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15064 216 VPLCSHCWIPLALKSFFLWLGYFNSLINPLIYTFFNKDFRKA 257
7tmA_D1-like_dopamine_R cd15057
D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G ...
11-45 2.04e-09

D1-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320185 [Multi-domain]  Cd Length: 299  Bit Score: 54.36  E-value: 2.04e-09
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  11 CISPGLFDVLTWLGYCNSTMNPIIYPlFMRDFKRA 45
Cdd:cd15057 265 CVPDTTFIVFVWLGWANSSLNPIIYA-FNADFRKA 298
7tmA_alpha-2D_AR cd15324
alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
4-46 2.25e-09

alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320447 [Multi-domain]  Cd Length: 256  Bit Score: 53.72  E-value: 2.25e-09
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 62087838   4 SPQAVC--DCISPG-LFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15324 211 SLHAVCrkRCGIPDaLFNLFFWIGYCNSSVNPIIYTIFNRDFRKAF 256
7tmA_D2-like_dopamine_R cd15053
D2-like dopamine receptors, member of the class A family of seven-transmembrane G ...
1-45 5.58e-09

D2-like dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. In contrast, activation of D2-like family receptors is linked to G proteins of the G(i) family, which inhibit adenylate cyclase. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320181 [Multi-domain]  Cd Length: 263  Bit Score: 52.73  E-value: 5.58e-09
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 62087838   1 CIPSPQAVCdCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15053 219 CPKLQNQSC-HVGPALFSLTTWLGYVNSFLNPIIYTIFNIEFRKA 262
7tmA_DmOct-betaAR-like cd15066
Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar ...
10-45 5.74e-09

Drosophila melanogaster beta-adrenergic receptor-like octopamine receptors and similar receptors in bilateria; member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Drosophila beta-adrenergic-like octopamine receptors and similar proteins. The biogenic amine octopamine is the invertebrate equivalent of vertebrate adrenergic neurotransmitters and exerts its effects through different G protein-coupled receptor types. Insect octopamine receptors are involved in the modulation of carbohydrate metabolism, muscular tension, cognition and memory. The activation of octopamine receptors mediating these actions leads to an increase in adenylate cyclase activity, thereby increasing cAMP levels. In Drosophila melanogaster, three subgroups have been classified on the basis of their structural homology and functional equivalents with vertebrate beta-adrenergic receptors: DmOctBeta1R, DmOctBeta2R, and DmOctBeta3R.


Pssm-ID: 320194 [Multi-domain]  Cd Length: 265  Bit Score: 52.76  E-value: 5.74e-09
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPG-LFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15066 228 ACPYPPiLVSILFWIGYFNSTLNPLIYAYFNRDFREA 264
7tmA_TAAR1 cd15314
trace amine-associated receptor 1 and similar receptors, member of the class A family of ...
12-46 6.07e-09

trace amine-associated receptor 1 and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptor 1 (TAAR1) is one of the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. TAAR1 is coupled to the Gs protein, which leads to activation of adenylate cyclase, and is thought to play functional role in the regulation of brain monoamines. TAAR1 is also shown to be activated by psychoactive compounds such as Ecstasy (MDMA), amphetamine and LSD. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320438 [Multi-domain]  Cd Length: 282  Bit Score: 52.63  E-value: 6.07e-09
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15314 248 IPPVLIEVLNWLGYSNSTLNPFIYAFFYSWFRKAF 282
7tmA_alpha2B_AR cd15321
alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
4-46 1.14e-08

alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320444 [Multi-domain]  Cd Length: 268  Bit Score: 51.85  E-value: 1.14e-08
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 62087838   4 SPQAVCD--CISP-GLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15321 223 SLGAICPelCKVPhSLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAF 268
7tmA_Histamine_H2R cd15051
histamine subtype H2 receptor, member of the class A family of seven-transmembrane G ...
10-46 1.37e-08

histamine subtype H2 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H2R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H2R subtype selectively interacts with the G(s)-type G protein that activates adenylate cyclase, leading to increased cAMP production and activation of Protein Kinase A. H2R is found in various tissues such as the brain, stomach, and heart. Its most prominent role is in histamine-induced gastric acid secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320179 [Multi-domain]  Cd Length: 287  Bit Score: 51.95  E-value: 1.37e-08
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15051 251 DNINETALSVVLWLGYANSALNPILYAFLNRDFRRAF 287
7tmA_tyramine_R-like cd15061
tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
6-45 2.10e-08

tyramine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine-specific receptors and similar proteins found in insects and other invertebrates. These tyramine receptors form a distinct receptor family that is phylogenetically different from the other tyramine/octopamine receptors which also found in invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320189 [Multi-domain]  Cd Length: 256  Bit Score: 51.21  E-value: 2.10e-08
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   6 QAVCDC-ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15061 215 EPFCDCqFSEALSTAFTWLGYFNSVINPFIYAFYNKDFRRA 255
7tmA_TAAR2_3_4 cd15312
trace amine-associated receptors 2, 3, 4, and similar receptors, member of the class A family ...
15-46 2.30e-08

trace amine-associated receptors 2, 3, 4, and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; TAAR2, TAAR3, and TAAR4 are among the 15 identified trace amine-associated receptor subtypes, which form a distinct subfamily within the class A G protein-coupled receptor family. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320437 [Multi-domain]  Cd Length: 289  Bit Score: 51.20  E-value: 2.30e-08
                        10        20        30
                ....*....|....*....|....*....|..
gi 62087838  15 GLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15312 258 DLFDALVWLGYFNSTCNPLIYGFFYPWFQKAF 289
7tmA_Histamine_H1R cd15050
histamine subtype H1 receptor, member of the class A family of seven-transmembrane G ...
7-45 2.44e-08

histamine subtype H1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine receptor subtype H1R, a member of histamine receptor family, which belongs to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). H1R selectively interacts with the G(q)-type G protein that activates phospholipase C and the phosphatidylinositol pathway. Antihistamines, a widely used anti-allergy medication, act on the H1 subtype and produce drowsiness as a side effect. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320178 [Multi-domain]  Cd Length: 263  Bit Score: 50.89  E-value: 2.44e-08
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 62087838   7 AVC-DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15050 223 AFCkNCCNENLHMFTIWLGYINSTLNPFIYPLCNENFKKT 262
7tmA_D3_dopamine_R cd15310
D3 subtype of the D2-like family of dopamine receptors, member of the class A family of ...
12-46 2.61e-08

D3 subtype of the D2-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. Activation of D2-like family receptors is linked to G proteins of the G(i) family. This leads to a decrease in adenylate cyclase activity, thereby decreasing cAMP levels. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320436 [Multi-domain]  Cd Length: 259  Bit Score: 51.12  E-value: 2.61e-08
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15310 225 VPPELYSATTWLGYVNSALNPVIYTTFNIEFRRAF 259
7tmA_5-HT7 cd15329
serotonin receptor subtype 7, member of the class A family of seven-transmembrane G ...
9-44 3.76e-08

serotonin receptor subtype 7, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT7 receptor, one of 14 mammalian serotonin receptors, is a member of the class A of GPCRs and is activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT7 receptor mainly couples to Gs protein, which positively stimulates adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. 5-HT7 receptor is expressed in various human tissues, mainly in the brain, the lower gastrointestinal tract and in vital blood vessels including the coronary artery. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320452 [Multi-domain]  Cd Length: 260  Bit Score: 50.35  E-value: 3.76e-08
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838   9 CDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKR 44
Cdd:cd15329 223 CSCIPLWLSRLFLWLGYANSFLNPIIYAKFNREFRT 258
7tmA_tyramine_octopamine_R-like cd15060
tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G ...
11-45 4.47e-08

tyramine/octopamine receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes tyramine/octopamine receptors and similar proteins found in insects and other invertebrates. Both octopamine and tyramine mediate their actions via G protein-coupled receptors (GPCRs) and are the invertebrate equivalent of vertebrate adrenergic neurotransmitters. In Drosophila, octopamine is involved in ovulation by mediating an egg release from the ovary, while a physiological role for tyramine in this process is not fully understood. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320188 [Multi-domain]  Cd Length: 260  Bit Score: 50.12  E-value: 4.47e-08
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  11 CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15060 225 SPSAKVVNFITWLGYVNSALNPVIYTIFNLDFRRA 259
7tmA_alpha2C_AR cd15323
alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G ...
16-46 1.19e-07

alpha-2 adrenergic receptors subtype C, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320446 [Multi-domain]  Cd Length: 261  Bit Score: 49.16  E-value: 1.19e-07
                        10        20        30
                ....*....|....*....|....*....|.
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15323 231 LFKFFFWIGYCNSSLNPVIYTIFNQDFRRSF 261
7tmA_D1A_dopamine_R cd15320
D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
11-46 1.34e-07

D1A (or D1) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320443 [Multi-domain]  Cd Length: 319  Bit Score: 49.23  E-value: 1.34e-07
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838  11 CISPGLFDVLTWLGYCNSTMNPIIYPlFMRDFKRAL 46
Cdd:cd15320 285 CISSTTFDVFVWFGWANSSLNPIIYA-FNADFRKAF 319
7tmA_5-HT1F cd15334
serotonin receptor subtype 1F, member of the class A family of seven-transmembrane G ...
8-46 1.37e-07

serotonin receptor subtype 1F, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320456 [Multi-domain]  Cd Length: 259  Bit Score: 48.79  E-value: 1.37e-07
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   8 VCD-C-ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15334 218 TCDsCyISEEMSNFLTWLGYINSLINPLIYTIFNEDFKKAF 258
7tmA_5-HT1A_invertebrates cd15331
serotonin receptor subtype 1A from invertebrates, member of the class A family of ...
4-45 2.14e-07

serotonin receptor subtype 1A from invertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320454 [Multi-domain]  Cd Length: 261  Bit Score: 48.50  E-value: 2.14e-07
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 62087838   4 SPQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15331 219 MPFCGAWQISRFLESFFLWLGYFNSLLNPIIYTIFSPDFRGA 260
7tmA_alpha1_AR cd15062
alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G ...
12-45 3.14e-07

alpha-1 adrenergic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320190 [Multi-domain]  Cd Length: 261  Bit Score: 47.87  E-value: 3.14e-07
                        10        20        30
                ....*....|....*....|....*....|....
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15062 227 PPEPVFKVVFWLGYFNSCLNPIIYPCSSREFKRA 260
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
22-46 5.11e-07

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335 [Multi-domain]  Cd Length: 291  Bit Score: 47.23  E-value: 5.11e-07
                        10        20
                ....*....|....*....|....*
gi 62087838  22 WLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15207 267 WLAYFNSCVNPIVYGYFNRNFRKGF 291
7tmA_alpha1B_AR cd15326
alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
16-46 9.61e-07

alpha-1 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320449 [Multi-domain]  Cd Length: 261  Bit Score: 46.42  E-value: 9.61e-07
                        10        20        30
                ....*....|....*....|....*....|.
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15326 231 LFKIIFWLGYFNSCLNPIIYPCSSKEFKRAF 261
7tmA_alpha1D_AR cd15327
alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
13-46 1.21e-06

alpha-1 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320450 [Multi-domain]  Cd Length: 261  Bit Score: 46.06  E-value: 1.21e-06
                        10        20        30
                ....*....|....*....|....*....|....
gi 62087838  13 SPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15327 228 SEMVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAF 261
7tmA_5-HT1E cd15335
serotonin receptor subtype 1E, member of the class A family of seven-transmembrane G ...
12-46 1.35e-06

serotonin receptor subtype 1E, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320457 [Multi-domain]  Cd Length: 258  Bit Score: 46.07  E-value: 1.35e-06
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15335 224 VSPEVADFLTWLGYVNSLVNPLLYTSFNEDFKLAF 258
7tmA_5-HT1A_vertebrates cd15330
serotonin receptor subtype 1A from vertebrates, member of the class A family of ...
16-46 1.66e-06

serotonin receptor subtype 1A from vertebrates, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320453 [Multi-domain]  Cd Length: 260  Bit Score: 45.74  E-value: 1.66e-06
                        10        20        30
                ....*....|....*....|....*....|.
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15330 230 LGAIINWLGYSNSLLNPIIYAYFNKDFQSAF 260
7tmA_5-HT2_insect-like cd15307
serotonin receptor subtype 2 from insects, member of the class A family of seven-transmembrane ...
2-52 1.79e-06

serotonin receptor subtype 2 from insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320433 [Multi-domain]  Cd Length: 279  Bit Score: 45.71  E-value: 1.79e-06
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 62087838   2 IPSPQAVCDC-ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPC 52
Cdd:cd15307 227 LPTVCAECEErISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLC 278
7tmA_Histamine_H3R_H4R cd15048
histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G ...
6-45 1.84e-06

histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine subtypes H3R and H4R, members of the histamine receptor family, which belong to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H3 and H4 receptors couple to the G(i)-proteins, which leading to the inhibition of cAMP formation. The H3R receptor functions as a presynaptic autoreceptors controlling histamine release and synthesis. The H4R plays an important role in histamine-mediated chemotaxis in mast cells and eosinophils. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320176 [Multi-domain]  Cd Length: 296  Bit Score: 45.76  E-value: 1.84e-06
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 62087838   6 QAVCD--CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15048 254 RSFCSgsCVDSYLYEFTFWLLWTNSAINPFLYAACHPRFRKA 295
7tmA_5-HT1B_1D cd15333
serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G ...
14-45 2.07e-06

serotonin receptor subtypes 1B and 1D, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT1 receptors, one of 14 mammalian 5-HT receptors, is a member of the class A of GPCRs and is activated by the endogenous neurotransmitter and peripheral signal mediator serotonin (5-hydroxytryptamine, 5-HT). The 5-HT1 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/o) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. The 5-HT1 receptor subfamily includes 5 subtypes: 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. There is no 5-HT1C receptor subtype, as it has been reclassified as the 5-HT2C receptor. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320455 [Multi-domain]  Cd Length: 265  Bit Score: 45.56  E-value: 2.07e-06
                        10        20        30
                ....*....|....*....|....*....|..
gi 62087838  14 PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15333 233 LAIFDFFTWLGYLNSLINPIIYTMSNEDFKQA 264
7tmA_D2_dopamine_R cd15309
D2 subtype of the D2-like family of dopamine receptors, member of the class A family of ...
9-46 3.25e-06

D2 subtype of the D2-like family of dopamine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. Activation of D2-like family receptors is linked to G proteins of the G(i) family. This leads to a decrease in adenylate cyclase activity, thereby decreasing cAMP levels. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320435 [Multi-domain]  Cd Length: 254  Bit Score: 45.03  E-value: 3.25e-06
                        10        20        30
                ....*....|....*....|....*....|....*....
gi 62087838   9 CDC-ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15309 216 CDCnIPPALYSAFTWLGYVNSAVNPIIYTTFNIEFRKAF 254
7tmA_D1B_dopamine_R cd15319
D1B (or D5) subtype dopamine receptor, member of the class A family of seven-transmembrane G ...
5-46 4.22e-06

D1B (or D5) subtype dopamine receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. The D1-like family receptors are coupled to G proteins of the G(s) family, which activate adenylate cyclase, causing cAMP formation and activation of protein kinase A. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320442 [Multi-domain]  Cd Length: 317  Bit Score: 44.95  E-value: 4.22e-06
                        10        20        30        40
                ....*....|....*....|....*....|....*....|..
gi 62087838   5 PQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPlFMRDFKRAL 46
Cdd:cd15319 277 PDAGLPCVSETTFDVFVWFGWANSSLNPIIYA-FNADFRKVF 317
7tmA_TAAR5-like cd15317
trace amine-associated receptor 5 and similar receptors, member of the class A family of ...
12-46 5.00e-06

trace amine-associated receptor 5 and similar receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Included in this group are mammalian TAAR5, TAAR6, TAAR8, TAAR9, and similar proteins. They are among the 15 identified trace amine-associated receptors (TAARs), a distinct subfamily within the class A G protein-coupled receptors. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320440 [Multi-domain]  Cd Length: 290  Bit Score: 44.36  E-value: 5.00e-06
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838  12 ISPGL-FDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15317 255 ITPAIvFDAVIWLGYFNSAFNPFIYAFFYPWFRKAF 290
7tmA_5-HT2C cd15305
serotonin receptor subtype 2C, member of the class A family of seven-transmembrane G ...
16-52 7.73e-06

serotonin receptor subtype 2C, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341346 [Multi-domain]  Cd Length: 275  Bit Score: 44.13  E-value: 7.73e-06
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPC 52
Cdd:cd15305 239 LLNVFVWVGYVSSGINPLVYTLFNKTYRRAFSNYIRC 275
7tmA_5-HT2B cd15306
serotonin receptor subtype 2B, member of the class A family of seven-transmembrane G ...
16-52 8.24e-06

serotonin receptor subtype 2B, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341347 [Multi-domain]  Cd Length: 277  Bit Score: 44.05  E-value: 8.24e-06
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  16 LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPC 52
Cdd:cd15306 240 LMEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITC 276
7tmA_D4_dopamine_R cd15308
D4 dopamine receptor of the D2-like family, member of the class A family of ...
6-43 4.09e-05

D4 dopamine receptor of the D2-like family, member of the class A family of seven-transmembrane G protein-coupled receptors; Dopamine receptors are members of the class A G protein-coupled receptors that are involved in many neurological processes in the central nervous system (CNS). The neurotransmitter dopamine is the primary endogenous agonist for dopamine receptors. Dopamine receptors consist of at least five subtypes: D1, D2, D3, D4, and D5. The D1 and D5 subtypes are members of the D1-like family of dopamine receptors, whereas the D2, D3 and D4 subtypes are members of the D2-like family. Activation of D2-like family receptors is linked to G proteins of the G(i) family. This leads to a decrease in adenylate cyclase activity, thereby decreasing cAMP levels. Dopamine receptors are major therapeutic targets for neurological and psychiatric disorders such as drug abuse, depression, schizophrenia, or Parkinson's disease.


Pssm-ID: 320434 [Multi-domain]  Cd Length: 258  Bit Score: 41.75  E-value: 4.09e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|
gi 62087838   6 QAVCDC--ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFK 43
Cdd:cd15308 216 RALCEScsIPPQLISIVTWLGYVNSALNPVIYTVFNAEFR 255
7tmA_5-HT4 cd15056
serotonin receptor subtype 4, member of the class A family of seven-transmembrane G ...
22-45 5.37e-05

serotonin receptor subtype 4, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT4 subtype is a member of the serotonin receptor family that belongs to the class A G protein-coupled receptors, and binds the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the mammalian central nervous system (CNS). 5-HT4 receptors are selectively linked to G proteins of the G(s) family, which positively stimulate adenylate cyclase, causing cAMP formation and activation of protein kinase A. 5-HT4 receptor-specific agonists have been shown to enhance learning and memory in animal studies. Moreover, hippocampal 5-HT4 receptor expression has been reported to be inversely correlated with memory performance in humans. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320184 [Multi-domain]  Cd Length: 294  Bit Score: 41.71  E-value: 5.37e-05
                        10        20
                ....*....|....*....|....
gi 62087838  22 WLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15056 270 WLGYINSGLNPFLYAFFNKSFRRA 293
7tmA_mAChR cd15049
muscarinic acetylcholine receptor subfamily, member of the class A family of ...
10-46 1.14e-04

muscarinic acetylcholine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341322 [Multi-domain]  Cd Length: 262  Bit Score: 40.38  E-value: 1.14e-04
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15049 226 KCIPDTLWSFGYWLCYINSTINPFCYALCNKTFRKTF 262
7tmA_alpha1A_AR cd15325
alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
13-46 1.34e-04

alpha-1 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-1 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that primarily mediate smooth muscle contraction: alpha-1A, alpha-1B, and alpha-1D. Activation of alpha-1 receptors by catecholamines such as norepinephrine and epinephrine couples to the G(q) protein, which then activates the phospholipase C pathway, leading to an increase in IP3 and calcium. Consequently, the elevation of intracellular calcium concentration leads to vasoconstriction in smooth muscle of blood vessels. In addition, activation of alpha-1 receptors by phenylpropanolamine (PPA) produces anorexia and may induce appetite suppression in rats.


Pssm-ID: 320448 [Multi-domain]  Cd Length: 261  Bit Score: 40.26  E-value: 1.34e-04
                        10        20        30
                ....*....|....*....|....*....|....
gi 62087838  13 SPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15325 228 SDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 261
7tmA_Beta_AR cd15058
beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane ...
10-45 1.35e-04

beta adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta adrenergic receptor (beta adrenoceptor), also known as beta AR, is activated by hormone adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate, as well as pulmonary physiology. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of beta-ARs can lead to cardiac dysfunction such as arrhythmias or heart failure. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320186 [Multi-domain]  Cd Length: 305  Bit Score: 40.51  E-value: 1.35e-04
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMrDFKRA 45
Cdd:cd15058 270 NLPPGEVFLLLNWLGYINSGLNPIIYCRSP-EFRTA 304
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
12-46 2.09e-04

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 39.89  E-value: 2.09e-04
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd14993 262 NFLLILPFAQLLGYSNSAINPIIYCFMSKKFRRGF 296
7tmA_TAAR6_8_9 cd15316
trace amine-associated receptors 6, 8, and 9, member of the class A family of ...
12-46 2.43e-04

trace amine-associated receptors 6, 8, and 9, member of the class A family of seven-transmembrane G protein-coupled receptors; Included in this group are mammalian TAAR6, TAAR8, TAAR9, and similar proteins. They are among the 15 identified amine-associated receptors (TAARs), a distinct subfamily within the class A G protein-coupled receptors. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320439 [Multi-domain]  Cd Length: 290  Bit Score: 39.46  E-value: 2.43e-04
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  12 ISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15316 256 TPPYIYEICCWCAYYNSAMNPLIYALFYPWFRKAI 290
7tmA_TAAR5 cd15318
trace amine-associated receptor 5, member of the class A family of seven-transmembrane G ...
14-46 3.02e-04

trace amine-associated receptor 5, member of the class A family of seven-transmembrane G protein-coupled receptors; The trace amine-associated receptor 5 is one of the 15 identified amine-activated G protein-coupled receptors (TAARs), a distinct subfamily within the class A G protein-coupled receptors. Trace amines are endogenous amines of unknown function that have strong structural and metabolic similarity to classical monoamine neurotransmitters (serotonin, noradrenaline, adrenaline, dopamine, and histamine), which play critical roles in human and animal physiological activities such as cognition, consciousness, mood, motivation, perception, and autonomic responses. However, trace amines are found in the mammalian brain at very low concentrations compared to classical monoamines. Trace amines, including p-tyramine, beta-phenylethylamine, and tryptamine, are also thought to act as chemical messengers to exert their biological effects in vertebrates. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320441 [Multi-domain]  Cd Length: 282  Bit Score: 39.46  E-value: 3.02e-04
                        10        20        30
                ....*....|....*....|....*....|...
gi 62087838  14 PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15318 250 PLLFDIIIWFAYFNSACNPLIYVFSYPWFRKAL 282
7tmA_mAChR_M1 cd17790
muscarinic acetylcholine receptor subtype M1, member of the class A family of ...
10-46 4.30e-04

muscarinic acetylcholine receptor subtype M1, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. M1 is the dominant mAChR subtype involved in learning and memory. It is linked to synaptic plasticity, neuronal excitability, and neuronal differentiation during early development. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341356 [Multi-domain]  Cd Length: 262  Bit Score: 38.80  E-value: 4.30e-04
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd17790 226 DCVPKTLWELGYWLCYVNSTVNPMCYALCNKSFRDTF 262
7tmA_5-HT5 cd15328
serotonin receptor subtype 5, member of the class A family of seven-transmembrane G ...
4-46 4.67e-04

serotonin receptor subtype 5, member of the class A family of seven-transmembrane G protein-coupled receptors; 5-HT5 receptor, one of 14 mammalian 5-HT receptors, is activated by the neurotransmitter and peripheral signal mediator serotonin (also known as 5-hydroxytryptamine or 5-HT). The 5-HT5A and 5-HT5B receptors have been cloned from rat and mouse, but only the 5-HT5A isoform has been identified in human because of the presence of premature stop codons in the human 5-HT5B gene, which prevents a functional receptor from being expressed. 5-HT5 receptors mediate inhibitory neurotransmission by coupling to G proteins of the G(i/0) family, which lead to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels and calcium influx. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in neurologic disorders such as migraine, schizophrenia, and depression.


Pssm-ID: 320451 [Multi-domain]  Cd Length: 259  Bit Score: 38.78  E-value: 4.67e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 62087838   4 SPQAVCDcISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15328 218 SPLCSCD-IPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAF 259
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
10-35 5.90e-04

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 38.42  E-value: 5.90e-04
                        10        20
                ....*....|....*....|....*.
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIY 35
Cdd:cd00637 246 SPLPRILYFLALLLAYLNSAINPIIY 271
7tmA_mAChR_DM1-like cd15301
muscarinic acetylcholine receptor DM1, member of the class A family of seven-transmembrane G ...
1-44 9.21e-04

muscarinic acetylcholine receptor DM1, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes muscarinic acetylcholine receptor DM1-like from invertebrates. Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320428 [Multi-domain]  Cd Length: 270  Bit Score: 37.88  E-value: 9.21e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....
gi 62087838   1 CIPSPQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKR 44
Cdd:cd15301 225 LIKAFFPCSDTIPTELWDFSYYLCYINSTINPLCYALCNAAFRR 268
7tmA_5-HT2A cd15304
serotonin receptor subtype 2A, member of the class A family of seven-transmembrane G ...
15-46 9.81e-04

serotonin receptor subtype 2A, member of the class A family of seven-transmembrane G protein-coupled receptors; The 5-HT2 receptors are a subfamily of serotonin receptors that bind the neurotransmitter serotonin (5HT; 5-hydroxytryptamine) in the central nervous system (CNS). The 5-HT2 subfamily is composed of three subtypes that mediate excitatory neurotransmission: 5-HT2A, 5-HT2B, and 5-HT2C. They are selectively linked to G proteins of the G(q/11) family and activate phospholipase C, which leads to activation of protein kinase C and calcium release. In the CNS, serotonin is involved in the regulation of appetite, mood, sleep, cognition, learning and memory, as well as implicated in diseases such as migraine, schizophrenia, and depression. Indeed, 5-HT2 receptors are attractive targets for a variety of psychoactive drugs, ranging from atypical antipsychotic drugs, antidepressants, and anxiolytics, which have an antagonistic action on 5-HT2 receptors, to hallucinogens, which act as agonists at postsynaptic 5-HT2 receptors. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341345 [Multi-domain]  Cd Length: 267  Bit Score: 37.99  E-value: 9.81e-04
                        10        20        30
                ....*....|....*....|....*....|..
gi 62087838  15 GLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15304 236 GLLNVFVWIGYLSSAVNPLVYTLFNKTYRSAF 267
7tmA_mAChR_M3 cd15299
muscarinic acetylcholine receptor subtype M3, member of the class A family of ...
10-55 2.06e-03

muscarinic acetylcholine receptor subtype M3, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. The M3 receptor is mainly located in smooth muscle, exocrine glands and vascular endothelium. It induces vomiting in the central nervous system and is a critical regulator of glucose homeostasis by modulating insulin secretion. Generally, M3 receptor causes contraction of smooth muscle resulting in vasoconstriction and increased glandular secretion. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320426 [Multi-domain]  Cd Length: 274  Bit Score: 36.85  E-value: 2.06e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCpRC 55
Cdd:cd15299 229 SCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLC-QC 273
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
12-44 2.11e-03

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218 [Multi-domain]  Cd Length: 279  Bit Score: 36.90  E-value: 2.11e-03
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 62087838  12 ISPGLFDVLTW-----LGYCNSTMNPIIYPLFMRDFKR 44
Cdd:cd15090 240 IPETTFQTVSWhfciaLGYTNSCLNPVLYAFLDENFKR 277
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
9-35 3.02e-03

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 36.51  E-value: 3.02e-03
                          10        20
                  ....*....|....*....|....*..
gi 62087838     9 CDCISPGLFDVLTWLGYCNSTMNPIIY 35
Cdd:pfam00001 230 LSRLLDKALSVTLWLAYVNSCLNPIIY 256
7tmA_Histamine_H3R cd15296
histamine receptor subtypes H3R and H3R-like, member of the class A family of ...
11-45 3.38e-03

histamine receptor subtypes H3R and H3R-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine subtypes H3R and H3R-like, members of the histamine receptor family, which belong to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H3 and H4 receptors couple to the G(i)-proteins, which leading to the inhibition of cAMP formation. The H3R receptor functions as a presynaptic autoreceptors controlling histamine release and synthesis. The H4R plays an important role in histamine-mediated chemotaxis in mast cells and eosinophils. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320423 [Multi-domain]  Cd Length: 271  Bit Score: 36.31  E-value: 3.38e-03
                        10        20        30
                ....*....|....*....|....*....|....*
gi 62087838  11 CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRA 45
Cdd:cd15296 236 CVPDYWYETSFWLLWVNSAINPVLYPLCHMSFRRA 270
7tmA_Beta1_AR cd15958
beta-1 adrenergic receptors (adrenoceptors), member of the class A family of ...
10-42 4.22e-03

beta-1 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-1 adrenergic receptor (beta-1 adrenoceptor), also known as beta-1 AR, is activated by adrenaline (epinephrine) and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of betrayers can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320624 [Multi-domain]  Cd Length: 298  Bit Score: 36.03  E-value: 4.22e-03
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIY---PLFMRDF 42
Cdd:cd15958 263 ELVPDWLFVFFNWLGYANSAFNPIIYcrsPDFRKAF 298
7tmA_mAChR_GAR-2-like cd15302
muscarinic acetylcholine receptor GAR-2 and similar proteins, member of the class A family of ...
10-46 4.44e-03

muscarinic acetylcholine receptor GAR-2 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320429 [Multi-domain]  Cd Length: 266  Bit Score: 35.87  E-value: 4.44e-03
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15302 230 PCVNETLYTISYYLCYMNSPINPFCYALANQQFKKTF 266
7tmA_GPR119_R_insulinotropic_receptor cd15104
G protein-coupled receptor 119, also called glucose-dependent insulinotropic receptor, member ...
6-46 4.74e-03

G protein-coupled receptor 119, also called glucose-dependent insulinotropic receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR119 is activated by oleoylethanolamide (OEA), a naturally occurring bioactive lipid with hypophagic and anti-obesity effects. Immunohistochemistry and double-immunofluorescence studies revealed the predominant GPR119 localization in pancreatic polypeptide (PP)-cells of islets. In addition, GPR119 expression is elevated in islets of obese hyperglycemic mice as compared to control islets, suggesting a possible involvement of this receptor in the development of obesity and diabetes. GPR119 has a significant sequence similarity with the members of the endothelial differentiation gene family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320232 [Multi-domain]  Cd Length: 283  Bit Score: 35.81  E-value: 4.74e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|...
gi 62087838   6 QAVCD--CISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15104 241 QALCDecKLYDVLEDYLWLLGLCNSLLNPWIYAFWQKEVRRAL 283
7tmA_Beta3_AR cd15959
beta-3 adrenergic receptors (adrenoceptors), member of the class A family of ...
6-42 5.41e-03

beta-3 adrenergic receptors (adrenoceptors), member of the class A family of seven-transmembrane G protein-coupled receptors; The beta-3 adrenergic receptor (beta-3 adrenoceptor), also known as beta-3 AR, is activated by adrenaline and plays important roles in regulating cardiac function and heart rate. The human heart contains three subtypes of the beta AR: beta-1 AR, beta-2 AR, and beta-3 AR. Beta-1 AR and beta-2 AR, which expressed at about a ratio of 70:30, are the major subtypes involved in modulating cardiac contractility and heart rate by positively stimulating the G(s) protein-adenylate cyclase-cAMP-PKA signaling pathway. In contrast, beta-3 AR produces negative inotropic effects by activating inhibitory G(i) proteins. The aberrant expression of betrayers can lead to cardiac dysfunction such as arrhythmias or heart failure.


Pssm-ID: 320625 [Multi-domain]  Cd Length: 302  Bit Score: 35.65  E-value: 5.41e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|.
gi 62087838   6 QAVCDCISPG-LFDVLTWLGYCNSTMNPIIY---PLFMRDF 42
Cdd:cd15959 262 KVFCRSLVPDpAFLFLNWLGYANSAFNPIIYcrsPDFRSAF 302
7tmA_Adenosine_R cd14968
adenosine receptor subfamily, member of the class A family of seven-transmembrane G ...
23-46 9.39e-03

adenosine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; The adenosine receptors (or P1 receptors), a family of G protein-coupled purinergic receptors, bind adenosine as their endogenous ligand. There are four types of adenosine receptors in human, designated as A1, A2A, A2B, and A3. Each type is encoded by a different gene and has distinct functions with some overlap. For example, both A1 and A2A receptors are involved in regulating myocardial oxygen consumption and coronary blood flow in the heart, while the A2A receptor also has a broad spectrum of anti-inflammatory effects in the body. These two receptors also expressed in the brain, where they have important roles in the release of other neurotransmitters such as dopamine and glutamate, while the A2B and A3 receptors found primarily in the periphery and play important roles in inflammation and immune responses. The A1 and A3 receptors preferentially interact with G proteins of the G(i/o) family, thereby lowering the intracellular cAMP levels, whereas the A2A and A2B receptors interact with G proteins of the G(s) family, activating adenylate cyclase to elevate cAMP levels.


Pssm-ID: 341316 [Multi-domain]  Cd Length: 285  Bit Score: 34.92  E-value: 9.39e-03
                        10        20
                ....*....|....*....|....
gi 62087838  23 LGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd14968 262 LSHANSAVNPIVYAYRIRKFRQTF 285
7tmA_mAChR_M5 cd15300
muscarinic acetylcholine receptor subtype M5, member of the class A family of ...
10-46 9.74e-03

muscarinic acetylcholine receptor subtype M5, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. M5 mAChR is primarily found in the central nervous system and mediates acetylcholine-induced dilation of cerebral blood vessels. Activation of M5 receptor triggers a variety of cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320427 [Multi-domain]  Cd Length: 262  Bit Score: 35.00  E-value: 9.74e-03
                        10        20        30
                ....*....|....*....|....*....|....*..
gi 62087838  10 DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRAL 46
Cdd:cd15300 226 DCIPLTLWHLGYWLCYVNSTVNPMCYALCNKTFRKTF 262
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH