NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2374221995|gb|WAB55659|]
View 

medium-wavelength sensitive opsin, partial [Nestor notabilis]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-73 4.24e-34

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15080:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 280  Bit Score: 116.86  E-value: 4.24e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15080   164 ESFVIYMFVVHFTIPLIVIFFCYGRLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAF 236
 
Name Accession Description Interval E-value
7tmA_MWS_opsin cd15080
medium wave-sensitive opsins, member of the class A family of seven-transmembrane G ...
1-73 4.24e-34

medium wave-sensitive opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Medium Wave-Sensitive opsin, which mediates visual transduction in response to light at medium wavelengths (green). Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 381742 [Multi-domain]  Cd Length: 280  Bit Score: 116.86  E-value: 4.24e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15080   164 ESFVIYMFVVHFTIPLIVIFFCYGRLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAF 236
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
1-73 4.19e-10

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 53.07  E-value: 4.19e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKeVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:pfam00001 149 VSYTLLISVLGFLLPLLVILVCYTLIIRTLRKSASKQKSSERTQRRRK-ALKTLAVVVVVFILCWLPYHIVNL 220
 
Name Accession Description Interval E-value
7tmA_MWS_opsin cd15080
medium wave-sensitive opsins, member of the class A family of seven-transmembrane G ...
1-73 4.24e-34

medium wave-sensitive opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Medium Wave-Sensitive opsin, which mediates visual transduction in response to light at medium wavelengths (green). Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 381742 [Multi-domain]  Cd Length: 280  Bit Score: 116.86  E-value: 4.24e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15080   164 ESFVIYMFVVHFTIPLIVIFFCYGRLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAF 236
7tmA_SWS2_opsin cd15077
short wave-sensitive 2 opsins, member of the class A family of seven-transmembrane G ...
1-72 5.55e-25

short wave-sensitive 2 opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Short Wave-Sensitive opsin 2 (SWS2), which mediates visual transduction in response to light at short wavelengths (violet to blue). Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320205 [Multi-domain]  Cd Length: 280  Bit Score: 93.35  E-value: 5.55e-25
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15077   164 ESYVMFLFCFCFGVPLSIIVFSYGRLLLTLRAVAKQQEQSASTQKAEREVTKMVVVMVLGFLVCWLPYASFA 235
7tmA_Opsins_type2_animals cd14969
type 2 opsins in animals, member of the class A family of seven-transmembrane G ...
2-73 1.59e-22

type 2 opsins in animals, member of the class A family of seven-transmembrane G protein-coupled receptors; This rhodopsin family represents the type 2 opsins found in vertebrates and invertebrates except sponge. Type 2 opsins primarily function as G protein coupled receptors and are responsible for vision as well as for circadian rhythm and pigment regulation. On the contrary, type 1 opsins such as bacteriorhodopsin and proteorhodopsin are found in both prokaryotic and eukaryotic microbes, functioning as light-gated ion channels, proton pumps, sensory receptors and in other unknown functions. Although these two opsin types share seven-transmembrane domain topology and a conserved lysine reside in the seventh helix, type 1 opsins do not activate G-proteins and are not evolutionarily related to type 2. Type 2 opsins can be classified into six distinct subfamilies including the vertebrate opsins/encephalopsins, the G(o) opsins, the G(s) opsins, the invertebrate G(q) opsins, the photoisomerases, and the neuropsins.


Pssm-ID: 381741 [Multi-domain]  Cd Length: 284  Bit Score: 86.88  E-value: 1.59e-22
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQ------QESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd14969   163 SYIVSLFVFCFFLPLAIIIFCYYKIYRTLRKMSKRAarrknsAITKRTKKAEKKVAKMVLVMIVAFLIAWTPYAVVSL 240
7tmA_Pinopsin cd15084
non-visual pinopsins, member of the class A family of seven-transmembrane G protein-coupled ...
2-72 1.10e-21

non-visual pinopsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Pinopsins are found in the pineal organ of birds, reptiles and amphibians, but are absent from teleosts and mammals. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Pinopsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320212 [Multi-domain]  Cd Length: 295  Bit Score: 84.91  E-value: 1.10e-21
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15084   173 SYILALFVTCFALPLSTIIFSYSNLLLTLRAVAAQQKESETTQRAEKEVTRMVIAMVMAFLICWLPYATFA 243
7tmA_SWS1_opsin cd15076
short wave-sensitive 1 opsins, member of the class A family of seven-transmembrane G ...
1-72 3.02e-21

short wave-sensitive 1 opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes Short Wave-Sensitive opsin 1 (SWS1), which mediates visual transduction in response to light at short wavelengths (ultraviolet to blue). Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320204 [Multi-domain]  Cd Length: 280  Bit Score: 83.33  E-value: 3.02e-21
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15076   164 EYYTWFLFIFCFIVPLSIIIFSYSQLLGALRAVAAQQQESASTQKAEREVSRMVVVMVGSFCLCYVPYAALA 235
7tmA_VA_opsin cd15082
non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane ...
2-70 9.73e-19

non-visual VA (vertebrate ancient) opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; The vertebrate ancient (VA) opsin photopigments were originally identified in salmon and they appear to have diverged early in the evolution of vertebrate opsins. VA opsins are localized in the inner retina and the brain in teleosts. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extraretinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity, and body color change. The VA opsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320210 [Multi-domain]  Cd Length: 291  Bit Score: 76.76  E-value: 9.73e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAV 70
Cdd:cd15082   176 TYIITFFTTCFILPLGVIFVSYGKLLQKLRKVSNTQGRLGNARKPERQVTRMVVVMIVAFMVCWTPYAA 244
7tmA_Opsin5_neuropsin cd15074
neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled ...
2-73 8.93e-17

neuropsin (Opsin-5), member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropsin, also known as Opsin-5, is a photoreceptor protein expressed in the retina, brain, testes, and spinal cord. Neuropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Mammalian neuropsin activates Gi protein-mediated photo-transduction pathway in a UV-dependent manner, whereas, in non-mammalian vertebrates, neuropsin is involved in regulating the photoperiodic control of seasonal reproduction in birds such as quail. As with other opsins, it may also act as a retinal photoisomerase.


Pssm-ID: 320202 [Multi-domain]  Cd Length: 284  Bit Score: 71.54  E-value: 8.93e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQ----KAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15074   165 SYIISIFIFCYLLPVLIIVFSYVKIIRKVKSSRKRVAGFDSRSkrqhKIERKVTKVAVLICAGFLIAWTPYAVVSM 240
7tmA_LWS_opsin cd15081
long wave-sensitive opsins, member of the class A family of seven-transmembrane G ...
1-72 5.46e-15

long wave-sensitive opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Long Wave-Sensitive opsin is also called red-sensitive opsin or red cone photoreceptor pigment, which mediates visual transduction in response to light at long wavelengths. Vertebrate cone opsins are expressed in cone photoreceptor cells of the retina and involved in mediating photopic vision, which allows color perception. The cone opsins can be classified into four classes according to their peak absorption wavelengths: SWS1 (ultraviolet sensitive), SWS2 (short wave-sensitive), MWS/LWS (medium/long wave-sensitive), and RH2 (medium wave-sensitive, rhodopsin-like opsins). Members of this group belong to the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320209 [Multi-domain]  Cd Length: 292  Bit Score: 66.85  E-value: 5.46e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15081   176 QSYMIVLMITCCIIPLAIIILCYLQVWLAIRAVAQQQKESESTQKAEKEVSRMVVVMIFAYCFCWGPYTFFA 247
7tmA_Parapinopsin cd15075
non-visual parapinopsin, member of the class A family of seven-transmembrane G protein-coupled ...
2-72 6.72e-13

non-visual parapinopsin, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the non-visual pineal pigment, parapinopsin, which is a member of the class A of the seven transmembrane G protein-coupled receptors. Parapinopsin serves as a UV-sensitive pigment for the wavelength discrimination in the pineal-related organs of lower vertebrates such as reptiles, amphibians, and fish. Although parapinopsin is phylogenetically related to vertebrate visual pigments such as rhodopsin, which releases its retinal chromophore and bleaches, the parapinopsin photoproduct is stable and does not bleach. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells.


Pssm-ID: 320203 [Multi-domain]  Cd Length: 279  Bit Score: 60.95  E-value: 6.72e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQ-QESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15075   163 SYILCYFSFCFAIPFAIILVSYGYLLWTLRQVAKLGvAEGGSTAKAEVQVARMVVVMVMAFLLCWLPYAAFA 234
7tmA_tmt_opsin cd15086
teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G ...
2-72 1.11e-12

teleost multiple tissue (tmt) opsin, member of the class A family of seven-transmembrane G protein-coupled receptors; Teleost multiple tissue (tmt) opsins are homologs of encephalopsin. Mouse encephalopsin (or panopsin) is highly expressed in the brain and testes, whereas the teleost homologs are localized to multiple tissues. The exact functions of the encephalopsins and tmt-opsins are unknown. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Tmt opsins belong to the class A of the G protein-coupled receptors and show strong homology to the vertebrate visual opsins.


Pssm-ID: 320214 [Multi-domain]  Cd Length: 276  Bit Score: 60.52  E-value: 1.11e-12
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESAttQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15086   163 SYIICLFIFCLLLPFLVMVYCYGRLLYAIKQVGKINKSTA--RKREQHVLLMVVTMVICYLLCWLPYGVMA 231
7tmA_Opsin_Gq_invertebrates cd15337
invertebrate Gq opsins, member of the class A family of seven-transmembrane G protein-coupled ...
2-72 4.30e-11

invertebrate Gq opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; The invertebrate Gq-coupled opsin subfamily includes the arthropod and mollusc visual opsins. Like the vertebrate visual opsins, arthropods possess color vision by the use of multiple opsins sensitive to different light wavelengths. The invertebrate Gq opsins are closely related to the vertebrate melanopsins, the primary photoreceptor molecules for non-visual responses to light, and the R1-R6 photoreceptors, which are the fly equivalent to the vertebrate rods. The Gq opsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320459 [Multi-domain]  Cd Length: 292  Bit Score: 56.18  E-value: 4.30e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATT------------QKAEKEVTRMVILMVLGFMLAWTPYA 69
Cdd:cd15337   165 LFILGLFIFGFLCPLLIIIFCYVNIIRAVRNHEKEMTQTAKSgmgkdtekndarKKAEIRIAKVAIILISLFLLSWTPYA 244

                  ...
gi 2374221995  70 VVA 72
Cdd:cd15337   245 VVA 247
7tmA_Peropsin cd15073
retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of ...
2-71 3.97e-10

retinal pigment epithelium-derived rhodopsin homolog, member of the class A family of seven-transmembrane G protein-coupled receptors; Peropsin, also known as a retinal pigment epithelium-derived rhodopsin homolog (RRH), is a visual pigment-like protein found exclusively in the apical microvilli of the retinal pigment epithelium. Peropsin belongs to the type 2 opsin family of the class A G-protein coupled receptors. Peropsin presumably plays a physiological role in the retinal pigment epithelium either by detecting light directly or monitoring the levels of retinoids, the primary light absorber in visual perception, or other pigment-related compounds in the eye.


Pssm-ID: 320201 [Multi-domain]  Cd Length: 280  Bit Score: 53.20  E-value: 3.97e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQ--KAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15073   163 SYTMSVIVVNFIVPLAVMFYCYYNVSRFVKKVLASDCLESVNIdwTDQNDVTKMSVIMIVMFLVAWSPYSIV 234
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
1-73 4.19e-10

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 53.07  E-value: 4.19e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKeVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:pfam00001 149 VSYTLLISVLGFLLPLLVILVCYTLIIRTLRKSASKQKSSERTQRRRK-ALKTLAVVVVVFILCWLPYHIVNL 220
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
2-73 4.66e-10

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 53.06  E-value: 4.66e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQ------KAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd00637   160 AYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRRRIRSSSSNSsrrrrrRRERKVTKTLLIVVVVFLLCWLPYFILLL 237
7tmA_photoreceptors_insect cd15079
insect photoreceptors R1-R6 and similar proteins, member of the class A family of ...
2-73 8.38e-10

insect photoreceptors R1-R6 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the insect photoreceptors and their closely related proteins. The Drosophila eye is composed of about 800 unit eyes called ommatidia, each of which contains eight photoreceptor cells (R1-R8). The six outer photoreceptors (R1-R6) function like the vertebrate rods and are responsible for motion detection in dim light and image formation. The R1-R6 photoreceptors express a blue-absorbing pigment, Rhodopsin 1(Rh1). The inner photoreceptors (R7 and R8) are considered the equivalent of the color-sensitive vertebrate cone cells, which express a range of different pigments. The R7 photoreceptors express one of two different UV absorbing pigments, either Rh3 or Rh4. Likewise, the R8 photoreceptors express either the blue absorbing pigment Rh5 or green absorbing pigment Rh6. These photoreceptors belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320207 [Multi-domain]  Cd Length: 292  Bit Score: 52.58  E-value: 8.38e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATT--------------QKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15079   163 SFVATIFVFAYVIPLIIIIYCYSFIVKAVFAHEKALREQAKKmnvvslrsnadankQSAEIRIAKVALTNVFLWFIAWTP 242

                  ....*.
gi 2374221995  68 YAVVAF 73
Cdd:cd15079   243 YAVVAL 248
7tmA_Parietopsin cd15085
non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled ...
2-72 9.74e-10

non-visual parietopsins, member of the class A family of seven-transmembrane G protein-coupled receptors; Parietopsin is a non-visual green light-sensitive opsin that was initially identified in the parietal eye of lizards. The vertebrate non-visual opsin family includes pinopsins, parapinopsin, VA (vertebrate ancient) opsins, and parietopsins. These non-visual opsins are expressed in various extra-retinal tissues and/or in non-rod, non-cone retinal cells. They are thought to be involved in light-dependent physiological functions such as photo-entrainment of circadian rhythm, photoperiodicity and body color change. Parietopsin belongs to the class A of the G protein-coupled receptors and shows strong homology to the vertebrate visual opsins.


Pssm-ID: 320213 [Multi-domain]  Cd Length: 280  Bit Score: 52.16  E-value: 9.74e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVRE--AAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15085   163 SYLILYFLMCFVIPVAIIGFSYGNVLRSLHKlnKKIEQQGGKNCPEEEERAVIMVLAMVIAFLICWLPYTVFA 235
7tmA_Melanopsin-like cd15083
vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane ...
2-72 3.39e-09

vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represent the Gq-coupled rhodopsin subfamily consists of melanopsins, insect photoreceptors R1-R6, invertebrate Gq opsins as well as their closely related opsins. Melanopsins (also called Opsin-4) are the primary photoreceptor molecules for non-visual functions such as the photo-entrainment of the circadian rhythm and pupillary constriction in mammals. Mammalian melanopsins are expressed only in the inner retina, whereas non-mammalian vertebrate melanopsins are localized in various extra-retinal tissues such as iris, brain, pineal gland, and skin. The outer photoreceptors (R1-R6) are the insect Drosophila equivalent to the vertebrate rods and are responsible for image formation and motion detection. The invertebrate G(q) opsins includes the arthropod and mollusk visual opsins as well as invertebrate melanopsins, which are also found in vertebrates. Arthropods possess color vision by the use of multiple opsins sensitive to different light wavelengths. Members of this subfamily belong to the class A of the G protein-coupled receptors and have seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320211 [Multi-domain]  Cd Length: 291  Bit Score: 50.79  E-value: 3.39e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESAT------------TQKAEKEVTRMVILMVLGFMLAWTPYA 69
Cdd:cd15083   164 SYVICLLIFGFVLPLLIIIYCYSFIFRAVRRHEKAMKEMAKrfskselsspkaRRQAEVKTAKIALLLVLLFCLAWTPYA 243

                  ...
gi 2374221995  70 VVA 72
Cdd:cd15083   244 VVA 246
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
4-70 5.03e-09

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 50.37  E-value: 5.03e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   4 VLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATT-QKAEKEVTRMVILMVLGFMLAWTPYAV 70
Cdd:cd14970   166 TIYTFVLGFAVPLLVITVCYSLIIRRLRSSRNLSTSGAREkRRARRKVTRLVLVVVAVFVVCWLPFHV 233
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
3-71 1.02e-08

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221 [Multi-domain]  Cd Length: 280  Bit Score: 49.38  E-value: 1.02e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQeSATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15093   165 FIIYTFVLGFLLPLLIICLCYLLIVIKVKSAGLRAG-WQQRKRSERKVTRMVVMVVVVFVICWLPFYVL 232
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
3-72 1.41e-08

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 48.99  E-value: 1.41e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAeKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15088   164 FTIYHFILGFAVPLVVITVCYILILHRLARGVAPGNQSHGSSRT-KRVTKMVILIVVVFIVCWLPFHVVQ 232
7tmA_prokineticin-R cd15204
prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
2-72 2.86e-08

prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Prokineticins 1 (PROK1) and 2 (PROK2), also known as endocrine gland vascular endothelial factor and Bombina varigata 8, respectively, are multifunctional chemokine-like peptides that are highly conserved across species. Prokineticins can bind with similar affinities to two closely homologous 7-transmembrane G protein coupled receptors, PROKR1 and PROKR2, which are phylogenetically related to the tachykinin receptors. Prokineticins and their GPCRs are widely distributed in human tissues and are involved in numerous physiological roles, including gastrointestinal motility, generation of circadian rhythms, neuron migration and survival, pain sensation, angiogenesis, inflammation, and reproduction. Moreover, different point mutations in genes encoding PROK2 or its receptor (PROKR2) can lead to Kallmann syndrome, a disease characterized by delayed or absent puberty and impaired olfactory function.


Pssm-ID: 320332 [Multi-domain]  Cd Length: 288  Bit Score: 48.04  E-value: 2.86e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKV--REAAAQQQES-ATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15204   166 AYYLFLFVLEFVLPVLIMTLCYLRIVRKVwfRRVPGQQTEQiRRRLRRRRRKVRLLVVILTAFVLCWAPYYGYA 239
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
8-73 7.28e-08

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 47.21  E-value: 7.28e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKE--------VTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15203   172 LVLQFVIPLLIISFCYFRISLKLRKRVKKKRGKRTLSSRRRRselrrkrrTNRLLIAMVVVFAVCWLPLNLFNL 245
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
3-71 1.13e-07

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639 [Multi-domain]  Cd Length: 274  Bit Score: 46.39  E-value: 1.13e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVReAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15973   163 FVIYTFLLGFLLPVLAIGLCYILIIGKMR-AVALKAGWQQRRKSEKKITRMVLMVVTVFVICWMPFYVV 230
7tmA_Encephalopsin cd15078
encephalopsins (opsin-3), member of the class A family of seven-transmembrane G ...
2-73 1.13e-07

encephalopsins (opsin-3), member of the class A family of seven-transmembrane G protein-coupled receptors; Encephalopsin, also called Opsin-3 or Panopsin, is a mammalian extra-retinal opsin that is highly localized in the brain. It is thought to play a role in encephalic photoreception. Encephalopsin belongs to the class A of the G protein-coupled receptors and shows strong homology to the vertebrate visual opsins.


Pssm-ID: 320206 [Multi-domain]  Cd Length: 279  Bit Score: 46.36  E-value: 1.13e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAA----QQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15078   160 SFVLLFFLGCLVVPLGIMAYCYGHILYEIRMLRSvedlQTFQVIKILKYEKKVAKMCLLMISTFLICWMPYAVVSL 235
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
2-67 1.29e-07

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223 [Multi-domain]  Cd Length: 288  Bit Score: 46.51  E-value: 1.29e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYG----RLICKVREAAAQQQESATTQKA-EKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15095   165 AYMIYTVLLTYVIPLAIIAVCYGlilrRLWRRSVDGNNQSEQLSERALRqKRKVTRMVIVVVVLFAICWLP 235
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
3-71 5.20e-07

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 44.51  E-value: 5.20e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQ-------QQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd14993   170 YNVALFVVLYVLPLLIISVAYSLIGRRLWRRKPPgdrgsanSTSSRRILRSKKKVARMLIVVVVLFALSWLPYYVL 245
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
2-68 1.06e-06

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaea stagnalis.


Pssm-ID: 320515 [Multi-domain]  Cd Length: 288  Bit Score: 43.94  E-value: 1.06e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREA----AAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPY 68
Cdd:cd15393   166 IYNLYLVCVQYFVPLVIICYAYTRIAVKIWGTkapgNAQDVRDDEILKNKKKVIKMLIIVVALFALCWLPL 236
7tmA_UII-R cd14999
urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled ...
3-70 1.20e-06

urotensin-II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The urotensin-II receptor (UII-R, also known as the hypocretin receptor) is a member of the class A rhodopsin-like G-protein coupled receptors, which binds the peptide hormone urotensin-II. Urotensin II (UII) is a vasoactive somatostatin-like or cortistatin-like peptide hormone. However, despite the apparent structural similarity to these peptide hormones, they are not homologous to UII. Urotensin II was first identified in fish spinal cord, but later found in humans and other mammals. In fish, UII is secreted at the back part of the spinal cord, in a neurosecretory centre called uroneurapophysa, and is involved in the regulation of the renal and cardiovascular systems. In mammals, urotensin II is the most potent mammalian vasoconstrictor identified to date and causes contraction of arterial blood vessels, including the thoracic aorta. The urotensin II receptor is a rhodopsin-like G-protein coupled receptor, which binds urotensin-II. The receptor was previously known as GPR14, or sensory epithelial neuropeptide-like receptor (SENR). The UII receptor is expressed in the CNS (cerebellum and spinal cord), skeletal muscle, pancreas, heart, endothelium and vascular smooth muscle. It is involved in the pathophysiological control of cardiovascular function and may also influence CNS and endocrine functions. Binding of urotensin II to the receptor leads to activation of phospholipase C, through coupling to G(q/11) family proteins. The resulting increase in intracellular calcium may cause the contraction of vascular smooth muscle.


Pssm-ID: 320130 [Multi-domain]  Cd Length: 282  Bit Score: 43.58  E-value: 1.20e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAV 70
Cdd:cd14999   164 YLTLLFSTSIVIPGLVIGYLYIRLARKYWLSQAAASNSSRKRLPKQKVLKMIFTIVLVFWACFLPFWI 231
7tmA_SSTR2 cd15971
somatostatin receptor type 2, member of the class A family of seven-transmembrane G ...
3-73 2.00e-06

somatostatin receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin, a polypeptide hormone that regulates a wide variety of physiological such as neurotransmission, endocrine secretion, cell proliferation, and smooth muscle contractility. SSTRs are composed of five distinct subtypes (SSTR1-5) which are encoded by separate genes on different chromosomes. SSTR2 plays critical roles in growth hormone secretion, glucagon secretion, and immune responses. SSTR2 is expressed in the normal human pituitary and in nearly all pituitary growth hormone adenomas.


Pssm-ID: 320637 [Multi-domain]  Cd Length: 279  Bit Score: 42.91  E-value: 2.00e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVReAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15971   164 FIIYTFILGFFVPLTIICLCYLFIIIKVK-SSGIRVGSSKRKKSEKKVTRMVSIVVAVFVFCWLPFYIFNV 233
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
3-67 2.39e-06

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102 [Multi-domain]  Cd Length: 281  Bit Score: 42.84  E-value: 2.39e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd14971   165 FALCTFLFGYLLPLLLICVCYAAMLRHLWRVAVRPVLSEGSRRAKRKVTRLVLVVVVLFAACWGP 229
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
3-71 4.14e-06

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636 [Multi-domain]  Cd Length: 276  Bit Score: 42.21  E-value: 4.14e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVR----EAAAQQQesattQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15970   165 FVVYTFLMGFLLPVIAICLCYILIIVKMRvvalKAGWQQR-----KRSERKITLMVMMVVTVFVICWMPFYVV 232
7tmA_Gal2_Gal3_R cd15097
galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G ...
8-71 4.59e-06

galanin receptor subtypes 2 and 3, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320225 [Multi-domain]  Cd Length: 279  Bit Score: 42.12  E-value: 4.59e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15097   168 FAFGYLIPVLVVSLSYTRTIKYLWTAVDPLEAMSESKRAKRKVTKMIIIVTALFCLCWLPHHVV 231
7tmA_Melanopsin cd15336
vertebrate melanopsins (Opsin-4), member of the class A family of seven-transmembrane G ...
2-72 5.08e-06

vertebrate melanopsins (Opsin-4), member of the class A family of seven-transmembrane G protein-coupled receptors; Melanopsin (also called Opsin-4) is the G protein-coupled photopigment that mediates non-visual responses to light. In mammals, these photoresponses include the photo-entrainment of circadian rhythm, pupillary constriction, and acute nocturnal melatonin suppression. Mammalian melanopsins are expressed only in the inner retina, whereas non-mammalian vertebrate melanopsins are localized in various extra-retinal tissues such as iris, brain, pineal gland, and skin. Melanopsins belong the class A of the G protein-coupled receptors and possess seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320458 [Multi-domain]  Cd Length: 290  Bit Score: 42.01  E-value: 5.08e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSY--------------GRLICKVREAAAQQQESattQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15336   164 AYTMLLFCFVFFIPLGIIIYCYlfiflairstgrevQKLGSQDRKEKAKQYQR---MKNEWKMAKIAFVVILLFVLSWSP 240

                  ....*
gi 2374221995  68 YAVVA 72
Cdd:cd15336   241 YACVA 245
7tmA_Bombesin_R-like cd15927
bombesin receptor subfamily, member of the class A family of seven-transmembrane G ...
4-70 6.38e-06

bombesin receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This bombesin subfamily of G-protein coupled receptors consists of neuromedin B receptor (NMBR), gastrin-releasing peptide receptor (GRPR), and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple mainly to the G proteins of G(q/11) family. NMBR functions as the receptor for the neuropeptide neuromedin B, a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. Gastrin-releasing peptide is an endogenous ligand for GRPR and shares high sequence homology with NMB in the C-terminal region. Both NMB and GRP possess bombesin-like biochemical properties. BRS-3 is classified as an orphan receptor and suggested to play a role in sperm cell division and maturation. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. The bombesin receptor family belongs to the seven transmembrane rhodopsin-like G-protein coupled receptors (class A GPCRs), which perceive extracellular signals and transduce them to guanine nucleotide-binding (G) proteins.


Pssm-ID: 320593 [Multi-domain]  Cd Length: 294  Bit Score: 41.48  E-value: 6.38e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   4 VLYMFVIHFIIPVVVIFFSY----GRLICKVREAAAQQQESATTQ-KAEKEVTRMVILMVLGFMLAWTPYAV 70
Cdd:cd15927   171 VLLRFLVYYLIPLLIIGVFYvlmaRHLIRSTRNIGSGQNQAAQRQiEARKKVAKTVLAFVVLFAVCWLPRHV 242
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
3-73 8.36e-06

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117 [Multi-domain]  Cd Length: 295  Bit Score: 41.21  E-value: 8.36e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKV-------------------REAAAQQQESATTQKAEKEVTRMVILMVLGFML 63
Cdd:cd14986   162 YITWLATYVFVIPLIILSYCYGRILRTIwirsrqktdrpiaptamscRSVSCVSSRVSLISRAKIKTIKMTLVIILAFIL 241
                          90
                  ....*....|
gi 2374221995  64 AWTPYAVVAF 73
Cdd:cd14986   242 CWTPYFIVQL 251
7tmA_SSTR5 cd15974
somatostatin receptor type 5, member of the class A family of seven-transmembrane G ...
2-71 1.04e-05

somatostatin receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR5 is coupled to inward rectifying K channels and phospholipase C, and plays critical roles in growth hormone and insulin secretion. SSTR5 acts as a negative regulator of PDX-1 (pancreatic and duodenal homeobox-1) expression, which is a conserved homeodomain-containing beta cell-specific transcription factor essentially involved in pancreatic development, among many other functions.


Pssm-ID: 320640 [Multi-domain]  Cd Length: 277  Bit Score: 40.94  E-value: 1.04e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQeSATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15974   161 AFIIYTAVLGFFGPLLVICLCYLLIVIKVKSSGLRVG-STKRRKSERKVTRMVVIIVVVFVFCWLPFYML 229
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
8-73 1.44e-05

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224 [Multi-domain]  Cd Length: 284  Bit Score: 40.74  E-value: 1.44e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVR-EAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15096   172 FLFSYLIPLTLICVLYMLMLRRLRrQKSPGGRRSAESQRGKRRVTRLVVVVVVVFAICWLPIHIILL 238
7tmA_SSTR3 cd15972
somatostatin receptor type 3, member of the class A family of seven-transmembrane G ...
3-71 1.72e-05

somatostatin receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR3 is coupled to inward rectifying potassium channels. SSTR3 plays critical roles in growth hormone secretion, endothelial cell cycle arrest and apoptosis. Furthermore, SSTR3 is expressed in the normal human pituitary and in nearly half of pituitary growth hormone adenomas.


Pssm-ID: 320638 [Multi-domain]  Cd Length: 279  Bit Score: 40.56  E-value: 1.72e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATT-QKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15972   162 FIIYTATLGFFCPLLVICLCYLLIVVKVRSSGRRVRATSTKrRGSERKVTRMVVIVVAAFVLCWLPFYAL 231
7tmA_GnRHR_vertebrate cd15383
vertebrate gonadotropin-releasing hormone receptors, member of the class A family of ...
3-73 2.31e-05

vertebrate gonadotropin-releasing hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. GnRHR is expressed predominantly in the gonadotrope membrane of the anterior pituitary as well as found in numerous extrapituitary tissues including lymphocytes, breast, ovary, prostate, and cancer cell lines. There are at least two types of GnRH receptors, GnRHR1 and GnRHR2, which couple primarily to G proteins of the Gq/11 family. GnRHR is closely related to the adipokinetic hormone receptor (AKH), which binds to a lipid-mobilizing hormone that is involved in control of insect metabolism. They share a common ancestor and are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320505 [Multi-domain]  Cd Length: 295  Bit Score: 40.04  E-value: 2.31e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKV-----------REAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15383   167 YNMFTFFCLFLLPLLIMIFCYTRILLEIsrrmkekkdsaKNEVALRSSSDNIPKARMRTLKMTIVIVSSFIVCWTPYYLL 246

                  ..
gi 2374221995  72 AF 73
Cdd:cd15383   247 GL 248
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
2-72 2.47e-05

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226 [Multi-domain]  Cd Length: 282  Bit Score: 40.09  E-value: 2.47e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLI----CKVREAaaqqqeSATTQKAEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15098   167 VYVVCTFVFGYLLPLLLITFCYAKVLnhlhKKLKNM------SKKSERSKKKTAQTVLVVVVVFGISWLPHHIIH 235
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
3-71 2.58e-05

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335 [Multi-domain]  Cd Length: 291  Bit Score: 39.91  E-value: 2.58e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKV------REAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15207   166 YTTSLFVLCYVAPLLIIAVLYVRIGYRLwfkpvpGGGSASREAQAAVSKKKVRVIKMLIVVVVLFALSWLPLHTV 240
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
3-71 2.72e-05

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 39.94  E-value: 2.72e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAekevTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd14982   165 IVLIALVVGFLIPLLIILVCYSLIIRALRRRSKQSQKSVRKRKA----LRMILIVLAVFLVCFLPYHVT 229
7tmA_AKHR cd15382
adipokinetic hormone receptor, member of the class A family of seven-transmembrane G ...
12-73 2.84e-05

adipokinetic hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flight, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. AKH is structurally related to the mammalian gonadotropin-releasing hormone (GnRH) and they share a common ancestor. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320504 [Multi-domain]  Cd Length: 298  Bit Score: 39.60  E-value: 2.84e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995  12 FIIPVVVIFFSYGRLICKVREAAAQQQESATTQ---------------KAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15382   176 YALPLIIIVFCYSLILCEISRKSKEKKEDVSEKsssvrlrrssvglleRARSRTLKMTIVIVLVFIICWTPYFIMSL 252
7tmA_NPBWR cd15087
neuropeptide B/W receptors, member of the class A family of seven-transmembrane G ...
5-68 5.27e-05

neuropeptide B/W receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide B/W receptor 1 and 2 are members of the class A G-protein coupled receptors that bind the neuropeptides B and W, respectively. NPBWR1 (previously known as GPR7) is expressed predominantly in cerebellum and frontal cortex, while NPBWR2 (previously known as GPR8) is located mostly in the frontal cortex and is present in human, but not in rat and mice. These receptors are suggested to be involved in the regulation of food intake, neuroendocrine function, and modulation of inflammatory pain, among many others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320215 [Multi-domain]  Cd Length: 282  Bit Score: 38.95  E-value: 5.27e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   5 LYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATtQKAEKEVTRMVILMVLGFMLAWTPY 68
Cdd:cd15087   169 IYTLVLGFAIPVSTICILYTMMLYKLRNMRLNSNAKAL-DKAKKKVTLMVLVVLAVCLFCWTPF 231
7tmA_GnRHR-like cd15195
gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A ...
3-71 5.98e-05

gonadotropin-releasing hormone and adipokinetic hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Gonadotropin-releasing hormone (GnRH) and adipokinetic hormone (AKH) receptors share strong sequence homology to each other, suggesting that they have a common evolutionary origin. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Adipokinetic hormone (AKH) is a lipid-mobilizing hormone that is involved in control of insect metabolism. Generally, AKH behaves as a typical stress hormone by mobilizing lipids, carbohydrates and/or certain amino acids such as proline. Thus, it utilizes the body's energy reserves to fight the immediate stress problems and subdue processes that are less important. Although AKH is known to responsible for regulating the energy metabolism during insect flying, it is also found in insects that have lost its functional wings and predominantly walk for their locomotion. Both GnRH and AKH receptors are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320323 [Multi-domain]  Cd Length: 293  Bit Score: 38.92  E-value: 5.98e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQ----------QQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15195   167 YYFFTMILSFVIPLIITVTCYLLILFEISKMAKRardtpisnrrRSRTNSLERARMRTLRMTALIVLTFIVCWGPYYVL 245
7tmA_GPR151 cd15002
G protein-coupled receptor 151, member of the class A family of seven-transmembrane G ...
3-67 1.04e-04

G protein-coupled receptor 151, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 151 (GRP151) is an orphan receptor of unknown function. Its expression is conserved in habenular axonal projections of vertebrates and may be a promising novel target for psychiatric drug development. GPR151 shows high sequence similarity with galanin receptors (GALR). GPR151 is a member of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320133 [Multi-domain]  Cd Length: 280  Bit Score: 38.16  E-value: 1.04e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESaTTQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15002   165 FVKLYPLFVFCLPLTFALFYFWRAYGQCQRRGTKTQNL-RNQIRSRKLTHMLLSVVLAFTILWLP 228
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
3-67 1.16e-04

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132 [Multi-domain]  Cd Length: 266  Bit Score: 38.03  E-value: 1.16e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRlickvreaaaqqqesattqKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15001   167 YVVYLAIVIFFIPLIVMTFAYAR-------------------DTRKQVIKMLISVVVLFAVCWGP 212
7tmA_C5aR cd15114
complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of ...
8-71 1.55e-04

complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320242 [Multi-domain]  Cd Length: 274  Bit Score: 37.77  E-value: 1.55e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVREAAAQQQesattqkaeKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15114   170 FLLGFLGPLVVIASCHGVLLVRTWSRRRQKS---------RRTLKVVTAVVVGFFLCWTPYHVV 224
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
7-67 1.55e-04

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217 [Multi-domain]  Cd Length: 281  Bit Score: 37.62  E-value: 1.55e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   7 MFVIHFIIPVVVIFFSYGRLICKVReAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15089   169 VFIFAFVVPILVITVCYGLMILRLR-SVRLLSGSKEKDRNLRRITRMVLVVVAAFIICWTP 228
7tmA_GPR150 cd15198
G protein-coupled receptor 150, member of the class A family of seven-transmembrane G ...
3-71 1.80e-04

G protein-coupled receptor 150, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors. Its endogenous ligand is not known. These receptors share a significant amino acid sequence similarity, suggesting that they have a common evolutionary origin.


Pssm-ID: 320326 [Multi-domain]  Cd Length: 299  Bit Score: 37.48  E-value: 1.80e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQ-----------QQESATTQ------KAEKEVTRMVILMVLGFMLAW 65
Cdd:cd15198   168 YATYEAVVGFVAPVVILGVCYGRLLLKWWERANQapgakkpwkkpSKSHLRATapsalpRAKVKTLKMTLVIALLFVGCS 247

                  ....*.
gi 2374221995  66 TPYAVV 71
Cdd:cd15198   248 LPYFIA 253
7tmA_MCHR1 cd15338
melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane ...
3-71 1.85e-04

melanin concentrating hormone receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320460 [Multi-domain]  Cd Length: 282  Bit Score: 37.48  E-value: 1.85e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESaTTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15338   168 FTLYQFFLAFALPLVVICVVYFKILQNMASTVAPLPQR-SLRVRTKKVTRMAVAICLAFFICWAPFYIL 235
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
2-68 2.44e-04

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 37.07  E-value: 2.44e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQeSATTQKAEKEVTRMVILMVLGFMLAWTPY 68
Cdd:cd15094   164 AFTLYTFLLGFAIPLLLISVFYTLVILRLRTVGPKNK-SKEKRRSHRKVTRLVLTVISVYIICWLPY 229
7tmA_MCHR2 cd15339
melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane ...
3-71 2.97e-04

melanin concentrating hormone receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320461 [Multi-domain]  Cd Length: 283  Bit Score: 36.72  E-value: 2.97e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEV-----TRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15339   163 YTLYQTITTFFFPLPLILICYILILCYTWEMYRKNKKAGRYNTSIPRQrvmrlTKMVLVLVGVFLVSAAPYHVI 236
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
7-67 3.15e-04

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218 [Multi-domain]  Cd Length: 279  Bit Score: 36.90  E-value: 3.15e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   7 MFVIHFIIPVVVIFFSYGRLICKVReAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15090   168 VFIFAFIMPVLIITVCYGLMILRLK-SVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTP 227
7tmA_BK-1 cd15380
bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled ...
4-73 3.15e-04

bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320502 [Multi-domain]  Cd Length: 286  Bit Score: 36.70  E-value: 3.15e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2374221995   4 VLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKeVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15380   166 RVELNIVGFLLPLAAIVFFNFHIIASLRERTEESRKRCGGLKDTK-ATRLILTLVLMFLVCWTPYHFFAF 234
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
2-73 3.59e-04

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288 [Multi-domain]  Cd Length: 280  Bit Score: 36.59  E-value: 3.59e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVReaaaqqqESATTQKAEK-EVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15160   163 SYNYARFLVGFLIPLSLILFFYRRVLRAVR-------QSPSLEREEKrKIIGLLLSIVVIFLLCFLPYHVVLL 228
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
9-70 3.83e-04

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287 [Multi-domain]  Cd Length: 286  Bit Score: 36.56  E-value: 3.83e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 2374221995   9 VIHFIIPVVVIFFSYGRLICKVREAAAQQQ---ESATTQKAekevtRMVILMVL-GFMLAWTPYAV 70
Cdd:cd15159   171 VIGFGVPVGIILFCYSQITLKLCRTAKENPlteKSGHHKKA-----CNVILLVLlVFVVCFSPYHL 231
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
12-73 5.35e-04

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320 [Multi-domain]  Cd Length: 284  Bit Score: 36.20  E-value: 5.35e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995  12 FIIPVVVIFFSYGRLICKVREAAAQQQESattQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd14985   174 FVLPLLIILTCYFHIARSLRKRYERTGKN---GRKRRKSLKIIFALVVAFLVCWLPFHFFKF 232
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
8-73 5.68e-04

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemoattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105 [Multi-domain]  Cd Length: 274  Bit Score: 36.12  E-value: 5.68e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVREaaaqqqesatTQKAEKEVTRMVIL-MVLGFMLAWTPYAVVAF 73
Cdd:cd14974   172 FLCGFLLPLLIIAICYSVIAVKLRR----------KRLAKSSKPLRVLLaVVVAFFLCWLPYHVFAL 228
7tmA_ETH-R cd14997
ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G ...
2-71 6.18e-04

ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the ecdysis-triggering hormone receptors found in insects, which are members of the class A family of seven-transmembrane G-protein coupled receptors. Ecdysis-triggering hormones are vital regulatory signals that govern the stereotypic physiological sequence leading to cuticle shedding in insects. Thus, the ETH signaling system has been a target for the design of more sophisticated insect-selective pest control strategies. Two subtypes of ecdysis-triggering hormone receptor were identified in Drosophila melanogaster. Blood-borne ecdysis-triggering hormone (ETH) activates the behavioral sequence through direct actions on the central nervous system. In insects, ecdysis is thought to be controlled by the interaction between peptide hormones; in particular between ecdysis-triggering hormone (ETH) from the periphery and eclosion hormone (EH) and crustacean cardioactive peptide (CCAP) from the central nervous system. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320128 [Multi-domain]  Cd Length: 294  Bit Score: 36.11  E-value: 6.18e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESAT-----TQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd14997   167 AYILSTIVVFFVVPLAILSGLYSVICRRLVGHPALESRRADaanrhTLRSRRQVVYMLITVVVLFFVCLLPFRVV 241
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
2-72 1.03e-03

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 35.44  E-value: 1.03e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   2 SYVLYMFVIhFIIPVVVIFFSYGRLICKVREAAAQQQEsattQKAekevTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15180   165 LRLLYHIVG-FLLPLAVMVYCYTSILLRLLRSSQGFQK----QRA----IRVIVAVVVVFFLCWTPYNIAL 226
7tmA_NPY2R cd15399
neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G ...
3-70 1.28e-03

neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320521 [Multi-domain]  Cd Length: 285  Bit Score: 35.18  E-value: 1.28e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAEKEVTRMVILMVLGFMLAWTPYAV 70
Cdd:cd15399   168 YSVSMLLIQYVLPLAIISYAYIRIWTKLKNHVSPGGGNDHYHQRRRKTTKMLVCVVVVFAVSWLPFHA 235
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
12-73 1.43e-03

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 34.94  E-value: 1.43e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995  12 FIIPVVVIFFSYGRLICKVREAAAQQQesattQKAekevTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15178   174 FLLPLVVMLFCYGFTIKTLLQTRSFQK-----HRA----MRVIFAVVLAFLLCWLPYNVTVL 226
7tmA_SUCNR1_GPR91 cd15378
succinate receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
3-70 1.90e-03

succinate receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Succinate receptor (SUCNR1) GPR91 exclusively couples to G(i) protein to inhibit cAMP production and also activates PLC-beta to increase intracellular calcium concentrations in an inositol phosphate dependent mechanism. Succinate, an intermediate molecule of the citric cycle, is shown to cause cardiac hypertrophy via GPR91 activation. Furthermore, succinate-induced GPR91 activation is involved in the regulation of renin-angiotensin system and is suggested to play an important role in the development of renovascular hypertension and diabetic nephropathy. SUCNR1 belongs to the class A GPCR superfamily and is phylogenetically related to the purinergic P2Y1-like receptor subfamily, whose members are coupled to G(q) protein to activate phospholipase C (PLC).


Pssm-ID: 320500 [Multi-domain]  Cd Length: 283  Bit Score: 34.69  E-value: 1.90e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAekevTRMVILMVLGFMLAWTPYAV 70
Cdd:cd15378   164 YSLFLTVTGFLIPLCVMCFFYYKIALFLKNRNRQLANATSFEKP----LTLVILAVVIFSVLFTPYHV 227
7tmA_LTB4R1 cd15121
leukotriene B4 receptor subtype 1 (LTB4R1 or BLT1), member of the class A family of ...
5-71 2.28e-03

leukotriene B4 receptor subtype 1 (LTB4R1 or BLT1), member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the Gq-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320249 [Multi-domain]  Cd Length: 278  Bit Score: 34.41  E-value: 2.28e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   5 LYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQesattqkaeKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15121   165 LFETITGFLLPFTAIVTCYSTIGRRLRSARFRRK---------RRTNRLVVLIIATFALFWLPYHVV 222
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
2-70 2.69e-03

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 34.22  E-value: 2.69e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   2 SYVLYMFVIH---FIIPVVVIFFSYGRLICKVREAAAQQQESATTQKAekevTRMVILMVLGFMLAWTPYAV 70
Cdd:cd15168   161 DYVIYSMVLTglgFLLPLLIILACYGLIVRALIRKLGEGVTSALRRKS----IRLVIIVLALFAVCFLPFHV 228
7tmA_GPR83 cd15389
G protein-coupled receptor 83, member of the class A family of seven-transmembrane G ...
5-67 2.79e-03

G protein-coupled receptor 83, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR83, also known as GPR72, is widely expressed in the brain, including hypothalamic nuclei which is involved in regulating energy balance and food intake. The hypothalamic expression of GPR83 is tightly regulated in response to nutrient availability and is decreased in obese mice. A recent study suggests that GPR83 has a critical role in the regulation of systemic energy metabolism via ghrelin-dependent and ghrelin-independent mechanisms. GPR83 shares a significant amino acid sequence identity with the tachykinin receptors, however its endogenous ligand is unknown.


Pssm-ID: 320511 [Multi-domain]  Cd Length: 285  Bit Score: 34.24  E-value: 2.79e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   5 LYMFVIHFIIPVVVIFFSYGRLICKV--REA--AAQQQESATTQKAEKEVTRMVILMVLGFMLAWTP 67
Cdd:cd15389   170 LATFILQYVLPLLIIGVAYTRVAKKLwlRNAigDVTTEQYVAQRRKKKKTIKMLMLVVLLFAICWLP 236
7tmA_C3aR cd15115
complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of ...
8-71 2.83e-03

complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320243 [Multi-domain]  Cd Length: 265  Bit Score: 33.97  E-value: 2.83e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   8 FVIHFIIPVVVIFFSYGRLICKVReaaaqqqeSATTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15115   162 AVFGFLLPLLIIAACYSFIAFRMQ--------RGRFAKSQSKTFRVIIAVVVAFFVCWAPYHII 217
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
1-71 3.22e-03

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334 [Multi-domain]  Cd Length: 269  Bit Score: 33.90  E-value: 3.22e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 2374221995   1 ESYVLYMFVIHFIIPVVVIFFSYGrLICKvreaaaqqqesaTTQKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15206   163 QAWYVFLDLMLLVIPGLVMSVAYG-LISW------------TLLEAKKRVIRMLFVIVVEFFICWTPLYVI 220
7tmA_NOFQ_opioid_R cd15092
nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G ...
7-73 4.15e-03

nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The nociceptin (NOP) receptor binds nociceptin or orphanin FQ, a 17 amino acid endogenous neuropeptide. The NOP receptor is involved in the modulation of various brain activities including instinctive and emotional behaviors. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320220 [Multi-domain]  Cd Length: 279  Bit Score: 33.69  E-value: 4.15e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2374221995   7 MFVIHFIIPVVVIFFSYGRLICKVREAAAQQQeSATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15092   168 VFLFSFIIPVLIISVCYSLMIRRLRGVRLLSG-SKEKDRNLRRITRLVLVVVAVFVGCWTPIQIFVL 233
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
5-68 4.15e-03

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321 [Multi-domain]  Cd Length: 279  Bit Score: 33.57  E-value: 4.15e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   5 LYMFVIHFIIPVVVIFFSYGRLICKVREAAaqQQESATTQKAEKEVtRMVILMVLGFMLAWTPY 68
Cdd:cd15193   161 LATLFLTFVLPLIVILFCYCSILVRLRRHF--HGAKRTGRRRRNSL-RIVFAIVTAFVLSWLPF 221
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
3-71 5.32e-03

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514 [Multi-domain]  Cd Length: 287  Bit Score: 33.49  E-value: 5.32e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKV--REAAAQQQESATTQKAE--KEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15392   166 YSLVLMILQYFVPLAVLVFTYTRIGIVVwaKRTPGEAENNRDQRMAEskRKLVKMMITVVAIFALCWLPLNIL 238
7tmA_GPR65_TDAG8 cd15365
proton-sensing G protein-coupled receptor 65, member of the class A family of ...
5-73 5.91e-03

proton-sensing G protein-coupled receptor 65, member of the class A family of seven-transmembrane G protein-coupled receptors; The T cell death associated gene-8 receptor (TDAG8, also known as GPR65) is a member of the proton-sensing G-protein-coupled receptor (GPCR) family which also includes the G2 accumulation receptor (G2A, also known as GPR132), ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4). Proton-sensing G-protein coupled receptors sense pH of 7.6 to 6.0 and mediates a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. Activation of TDAG8 by extracellular acidosis increases the cAMP production, stimulates Rho, and induces stress fiber formation. TDAG8 has also been shown to regulate the extracellular acidosis-induced inhibition of pro-inflammatory cytokine production in peritoneal macrophages.


Pssm-ID: 320487 [Multi-domain]  Cd Length: 277  Bit Score: 33.21  E-value: 5.91e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   5 LYMFVIHFIIPVVVIFFSYGRLICKVReaaaqqQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15365   166 LFRICLGYLLPLLIILFCYWKIYQAVR------SNQATEDQEKKKIFKLLLLITVTFVICFTPYHVVLL 228
7tmA_mAChR cd15049
muscarinic acetylcholine receptor subfamily, member of the class A family of ...
9-72 7.42e-03

muscarinic acetylcholine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; Muscarinic acetylcholine receptors (mAChRs) regulate the activity of many fundamental central and peripheral functions. The mAChR family consists of 5 subtypes M1-M5, which can be further divided into two major groups according to their G-protein coupling preference. The M1, M3 and M5 receptors selectively interact with G proteins of the G(q/11) family, whereas the M2 and M4 receptors preferentially link to the G(i/o) types of G proteins. Activation of mAChRs by agonist (acetylcholine) leads to a variety of biochemical and electrophysiological responses. In general, the exact nature of these responses and the subsequent physiological effects mainly depend on the molecular and pharmacological identity of the activated receptor subtype(s). All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341322 [Multi-domain]  Cd Length: 262  Bit Score: 33.06  E-value: 7.42e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2374221995   9 VIHFIIPVVVIFFSYGRLickVREAAAqqqesattqkaEKEVTRMVILMVLGFMLAWTPYAVVA 72
Cdd:cd15049   169 IAAFYLPVLVMTILYWRI---YRETAR-----------ERKAARTLSAILLAFIITWTPYNILV 218
7tmA_Vasopressin_Oxytocin cd15196
vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G ...
3-71 7.50e-03

vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) and oxytocin are synthesized in the hypothalamus and are released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320324 [Multi-domain]  Cd Length: 264  Bit Score: 32.98  E-value: 7.50e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 2374221995   3 YVLYMFVIHFIIPVVVIFFSYGRLICKVReaaaqqqesattqKAEKEVTRMVILMVLGFMLAWTPYAVV 71
Cdd:cd15196   163 YITWFTVAVFVVPLIILAFCYGRICYVVW-------------RAKIKTVKLTLVVVACYIVCWTPFFVV 218
7tmA_Retinal_GPR cd15072
retinal G protein coupled receptor, member of the class A family of seven-transmembrane G ...
2-73 9.41e-03

retinal G protein coupled receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents the retinal G-protein coupled receptor (RGR) found exclusively in retinal pigment epithelium (RPE) and Muller cells. RGR is a member of the class A rhodopsin-like receptor family. As with other opsins, RGR binds all-trans retinal and contains a conserved lysine reside on the seventh helix. RGR functions as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. Two mutations in RGR gene are found in patients with retinitis pigmentosa, indicating that RGR is essential to the visual process.


Pssm-ID: 320200 [Multi-domain]  Cd Length: 260  Bit Score: 32.72  E-value: 9.41e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 2374221995   2 SYVLYMFVIHFIIPVVVIFFSYgrlickvreaaaqqQESATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAF 73
Cdd:cd15072   159 SYLFTMAFFNFILPLFILLTSY--------------SSIEQKLKKEGHLRFNTGLPLLTLLICWGPYAILAL 216
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH