NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1845982730|ref|YP_009825062|]
View 

ORF9b protein [SARS coronavirus Tor2]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
bCoV_lipid_BD pfam09399
Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and ...
 1-98 1.10e-63

Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and SARS-like coronaviruses. It includes Protein 9b from SARS coronavirus 2 (SARS-CoV-2), human SARS coronavirus (SARS-CoV) and bat coronaviruses. Protein 9B is one of 8 accessory proteins in SARS-CoV. The gene (ORF 9b, also known as ORF 13) that encodes this protein is included within the nucleocapsid (N) gene (alternative ORF). Data suggest that protein 9b is a structural component of SARS-CoV virions and functions as an unusual lipid binding protein. SARS-CoV ORF-9b has been shown to localize to the outer mitochondrial membrane and to target mitochondrial antiviral signalling proteins (MAVS), suppressing innate immunity. Protein 9b from SARS CoV comprises 98 amino acids. It's structure has a novel fold which forms a dimeric tent-like beta structure with an amphipathic surface, and a central hydrophobic cavity that binds lipid molecules. This cavity is likely to be involved in membrane attachment.


:

Pssm-ID: 462787  Cd Length: 98  Bit Score: 187.61  E-value: 1.10e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1845982730  1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMT 80
Cdd:pfam09399  1 MDPNKINEMHPALHLVDPQIQLAITRMEDAMGQDQNNADPKVYPIILRLGSPLSLNMARKNLDSLEAKAFQLTPIAVQMT 80

                         90
                 ....*....|....*...
gi 1845982730 81 KLATTEELPDEFVVVTAK 98
Cdd:pfam09399 81 KLATTEELPDEFVVVTAK 98
 
Name Accession Description Interval E-value
bCoV_lipid_BD pfam09399
Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and ...
 1-98 1.10e-63

Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and SARS-like coronaviruses. It includes Protein 9b from SARS coronavirus 2 (SARS-CoV-2), human SARS coronavirus (SARS-CoV) and bat coronaviruses. Protein 9B is one of 8 accessory proteins in SARS-CoV. The gene (ORF 9b, also known as ORF 13) that encodes this protein is included within the nucleocapsid (N) gene (alternative ORF). Data suggest that protein 9b is a structural component of SARS-CoV virions and functions as an unusual lipid binding protein. SARS-CoV ORF-9b has been shown to localize to the outer mitochondrial membrane and to target mitochondrial antiviral signalling proteins (MAVS), suppressing innate immunity. Protein 9b from SARS CoV comprises 98 amino acids. It's structure has a novel fold which forms a dimeric tent-like beta structure with an amphipathic surface, and a central hydrophobic cavity that binds lipid molecules. This cavity is likely to be involved in membrane attachment.


Pssm-ID: 462787  Cd Length: 98  Bit Score: 187.61  E-value: 1.10e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1845982730  1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMT 80
Cdd:pfam09399  1 MDPNKINEMHPALHLVDPQIQLAITRMEDAMGQDQNNADPKVYPIILRLGSPLSLNMARKNLDSLEAKAFQLTPIAVQMT 80

                         90
                 ....*....|....*...
gi 1845982730 81 KLATTEELPDEFVVVTAK 98
Cdd:pfam09399 81 KLATTEELPDEFVVVTAK 98
SARS-CoV_ORF9b cd21955
accessory protein 9b of severe acute respiratory syndrome-associated coronavirus and similar ...
 10-98 1.61e-53

accessory protein 9b of severe acute respiratory syndrome-associated coronavirus and similar proteins; This model represents the accessory protein 9b (ORF9b) from Severe acute respiratory syndrome-associated coronavirus (SARS-CoV) and some related betacoronaviruses such as bat coronavirus. There are five essential genes in CoVs that result in the following gene products: Spike (S) protein, Membrane (M) glycoprotein, Nucleocapsid (N), Envelope (E) protein, and replicase/protease polyproteins (ORF1ab); all are required to produce a structurally complete viral particle. In addition, CoV genomes also contain ORFs coding for accessory proteins that are specific for certain CoV lineages or for a particular CoV. In general, CoV accessory proteins are considered to be dispensable for viral replication; however, several accessory proteins have been shown to exhibit functions in virus-host interactions during CoV infection. ORF9b is a product of an alternative open reading frame within the N gene from SARS coronavirus. It is a lipid-binding protein that has been shown to associate with intracellular vesicles in mammalian cells, consistent with a role in the assembly of the virion. ORF9b localizes to mitochondria and causes mitochondrial elongation by triggering ubiquitination and proteasomal degradation of dynamin-like protein 1, a host protein involved in mitochondrial fission. It also targets the mitochondrial-associated adaptor molecule MAVS signalosome to trigger the degradation of MAVS, TRAF3, and TRAF, which severely limits host cell interferon responses. There are slight differences in the genome organization of SARS-CoV-2 in different studies; not all SARS-CoV-2 isolates are reported as having ORF9b.


Pssm-ID: 409250  Cd Length: 89  Bit Score: 161.63  E-value: 1.61e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1845982730 10 PPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELP 89
Cdd:cd21955    1 PPALHLVDPQIQLTITRMEDAVVHGQNNADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVKMTKLATTEELP 80


                 ....*....
gi 1845982730 90 DEFVVVTAK 98
Cdd:cd21955   81 DEFVVVTAK 89
 
Name Accession Description Interval E-value
bCoV_lipid_BD pfam09399
Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and ...
 1-98 1.10e-63

Betacoronavirus lipid binding protein; This is a family of proteins found in SARS and SARS-like coronaviruses. It includes Protein 9b from SARS coronavirus 2 (SARS-CoV-2), human SARS coronavirus (SARS-CoV) and bat coronaviruses. Protein 9B is one of 8 accessory proteins in SARS-CoV. The gene (ORF 9b, also known as ORF 13) that encodes this protein is included within the nucleocapsid (N) gene (alternative ORF). Data suggest that protein 9b is a structural component of SARS-CoV virions and functions as an unusual lipid binding protein. SARS-CoV ORF-9b has been shown to localize to the outer mitochondrial membrane and to target mitochondrial antiviral signalling proteins (MAVS), suppressing innate immunity. Protein 9b from SARS CoV comprises 98 amino acids. It's structure has a novel fold which forms a dimeric tent-like beta structure with an amphipathic surface, and a central hydrophobic cavity that binds lipid molecules. This cavity is likely to be involved in membrane attachment.


Pssm-ID: 462787  Cd Length: 98  Bit Score: 187.61  E-value: 1.10e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1845982730  1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMT 80
Cdd:pfam09399  1 MDPNKINEMHPALHLVDPQIQLAITRMEDAMGQDQNNADPKVYPIILRLGSPLSLNMARKNLDSLEAKAFQLTPIAVQMT 80

                         90
                 ....*....|....*...
gi 1845982730 81 KLATTEELPDEFVVVTAK 98
Cdd:pfam09399 81 KLATTEELPDEFVVVTAK 98
SARS-CoV_ORF9b cd21955
accessory protein 9b of severe acute respiratory syndrome-associated coronavirus and similar ...
 10-98 1.61e-53

accessory protein 9b of severe acute respiratory syndrome-associated coronavirus and similar proteins; This model represents the accessory protein 9b (ORF9b) from Severe acute respiratory syndrome-associated coronavirus (SARS-CoV) and some related betacoronaviruses such as bat coronavirus. There are five essential genes in CoVs that result in the following gene products: Spike (S) protein, Membrane (M) glycoprotein, Nucleocapsid (N), Envelope (E) protein, and replicase/protease polyproteins (ORF1ab); all are required to produce a structurally complete viral particle. In addition, CoV genomes also contain ORFs coding for accessory proteins that are specific for certain CoV lineages or for a particular CoV. In general, CoV accessory proteins are considered to be dispensable for viral replication; however, several accessory proteins have been shown to exhibit functions in virus-host interactions during CoV infection. ORF9b is a product of an alternative open reading frame within the N gene from SARS coronavirus. It is a lipid-binding protein that has been shown to associate with intracellular vesicles in mammalian cells, consistent with a role in the assembly of the virion. ORF9b localizes to mitochondria and causes mitochondrial elongation by triggering ubiquitination and proteasomal degradation of dynamin-like protein 1, a host protein involved in mitochondrial fission. It also targets the mitochondrial-associated adaptor molecule MAVS signalosome to trigger the degradation of MAVS, TRAF3, and TRAF, which severely limits host cell interferon responses. There are slight differences in the genome organization of SARS-CoV-2 in different studies; not all SARS-CoV-2 isolates are reported as having ORF9b.


Pssm-ID: 409250  Cd Length: 89  Bit Score: 161.63  E-value: 1.61e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1845982730 10 PPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELP 89
Cdd:cd21955    1 PPALHLVDPQIQLTITRMEDAVVHGQNNADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVKMTKLATTEELP 80


                 ....*....
gi 1845982730 90 DEFVVVTAK 98
Cdd:cd21955   81 DEFVVVTAK 89
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH