NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|557357761|ref|NP_001273335|]
View 

appetite-regulating hormone isoform 4 precursor [Mus musculus]

Protein Classification

Motilin_ghrelin and Motilin_assoc domain-containing protein( domain architecture ID 10267282)

Motilin_ghrelin and Motilin_assoc domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Motilin_assoc pfam04643
Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies ...
36-76 1.62e-24

Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies C-terminal to motilin/ghrelin on the respective precursor peptide. Its function is unknown.


:

Pssm-ID: 368034  Cd Length: 59  Bit Score: 86.36  E-value: 1.62e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 557357761  36 QFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPA 76
Cdd:pfam04643 19 RFNAPFDIGIKLSGAQYQQHGQALGKFLQDILWEEAKETPA 59
Motilin_ghrelin super family cl04647
Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin ...
24-36 5.00e-03

Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin cells in the duodenal epithelium. It is released into the general circulation at about 100-min intervals during the inter-digestive state and is the most important factor in controlling the inter-digestive migrating contractions. Motilin also stimulates endogenous release of the endocrine pancreas. This family also includes ghrelin, a growth hormone secretagogue synthesized by endocrine cells in the stomach. Ghrelin stimulates growth hormone secretagogue receptors in the pituitary. These receptors are distinct from the growth hormone-releasing hormone receptors, and thus provide a means of controlling pituitary growth hormone release by the gastrointestinal system.


The actual alignment was detected with superfamily member pfam04644:

Pssm-ID: 461377  Cd Length: 28  Bit Score: 31.47  E-value: 5.00e-03
                         10
                 ....*....|...
gi 557357761  24 GSSFLSPEHQKAQ 36
Cdd:pfam04644  1 GSSFLSPEYQRMQ 13
 
Name Accession Description Interval E-value
Motilin_assoc pfam04643
Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies ...
36-76 1.62e-24

Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies C-terminal to motilin/ghrelin on the respective precursor peptide. Its function is unknown.


Pssm-ID: 368034  Cd Length: 59  Bit Score: 86.36  E-value: 1.62e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 557357761  36 QFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPA 76
Cdd:pfam04643 19 RFNAPFDIGIKLSGAQYQQHGQALGKFLQDILWEEAKETPA 59
Motilin_ghrelin pfam04644
Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin ...
24-36 5.00e-03

Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin cells in the duodenal epithelium. It is released into the general circulation at about 100-min intervals during the inter-digestive state and is the most important factor in controlling the inter-digestive migrating contractions. Motilin also stimulates endogenous release of the endocrine pancreas. This family also includes ghrelin, a growth hormone secretagogue synthesized by endocrine cells in the stomach. Ghrelin stimulates growth hormone secretagogue receptors in the pituitary. These receptors are distinct from the growth hormone-releasing hormone receptors, and thus provide a means of controlling pituitary growth hormone release by the gastrointestinal system.


Pssm-ID: 461377  Cd Length: 28  Bit Score: 31.47  E-value: 5.00e-03
                         10
                 ....*....|...
gi 557357761  24 GSSFLSPEHQKAQ 36
Cdd:pfam04644  1 GSSFLSPEYQRMQ 13
 
Name Accession Description Interval E-value
Motilin_assoc pfam04643
Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies ...
36-76 1.62e-24

Motilin/ghrelin-associated peptide; This family represents a peptide sequence that lies C-terminal to motilin/ghrelin on the respective precursor peptide. Its function is unknown.


Pssm-ID: 368034  Cd Length: 59  Bit Score: 86.36  E-value: 1.62e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 557357761  36 QFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPA 76
Cdd:pfam04643 19 RFNAPFDIGIKLSGAQYQQHGQALGKFLQDILWEEAKETPA 59
Motilin_ghrelin pfam04644
Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin ...
24-36 5.00e-03

Motilin/ghrelin; Motilin is a gastrointestinal regulatory polypeptide produced by motilin cells in the duodenal epithelium. It is released into the general circulation at about 100-min intervals during the inter-digestive state and is the most important factor in controlling the inter-digestive migrating contractions. Motilin also stimulates endogenous release of the endocrine pancreas. This family also includes ghrelin, a growth hormone secretagogue synthesized by endocrine cells in the stomach. Ghrelin stimulates growth hormone secretagogue receptors in the pituitary. These receptors are distinct from the growth hormone-releasing hormone receptors, and thus provide a means of controlling pituitary growth hormone release by the gastrointestinal system.


Pssm-ID: 461377  Cd Length: 28  Bit Score: 31.47  E-value: 5.00e-03
                         10
                 ....*....|...
gi 557357761  24 GSSFLSPEHQKAQ 36
Cdd:pfam04644  1 GSSFLSPEYQRMQ 13
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH