NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|663070941|ref|NP_001284596|]
View 

tetratricopeptide repeat protein 39A isoform 8 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Iml2-TPR_39 super family cl28743
Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to ...
 1-59 2.99e-15

Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to humans, including fungal Inclusion body clearance protein Iml2 protein, animal tetratricopeptide repeat protein 39A/B/C (TT39A/B/C) and some uncharacterized proteins. Members of this family carry a tetratricopeptide repeat pfam07719 at their C terminus. This entry includes Iml2 and its paralogue-YKR018C from S. cerevisiae; Iml2 localizes to the cytoplasm and nucleus, and its expression is increased in response to DNA replication stress. It is found to be involved in lipid droplet-mediated inclusion body clearing after protein folding stress. In humans, TTC39A (also known as DEME6) is expressed in primary breast carcinomas but not in normal breast tissue, and has a putative eukaryotic RNP-1 RNA binding region and a candidate anchoring transmembrane domain. It is coordinately regulated with oestrogen receptor, but is not necessarily oestradiol-responsive. TTC39B has been linked to lipid metabolism.


The actual alignment was detected with superfamily member pfam10300:

Pssm-ID: 463047 [Multi-domain]  Cd Length: 469  Bit Score: 71.61  E-value: 2.99e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 663070941    1 MMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEkgPENEYSVDDECLVKLLKGLCLKYL 59
Cdd:pfam10300 413 LIYFWNGFSRMGKKPLLTESVLKLIEKALKANP--TSEAQEPDDKCLKQLLKGLCLRHL 469
 
Name Accession Description Interval E-value
Iml2-TPR_39 pfam10300
Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to ...
 1-59 2.99e-15

Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to humans, including fungal Inclusion body clearance protein Iml2 protein, animal tetratricopeptide repeat protein 39A/B/C (TT39A/B/C) and some uncharacterized proteins. Members of this family carry a tetratricopeptide repeat pfam07719 at their C terminus. This entry includes Iml2 and its paralogue-YKR018C from S. cerevisiae; Iml2 localizes to the cytoplasm and nucleus, and its expression is increased in response to DNA replication stress. It is found to be involved in lipid droplet-mediated inclusion body clearing after protein folding stress. In humans, TTC39A (also known as DEME6) is expressed in primary breast carcinomas but not in normal breast tissue, and has a putative eukaryotic RNP-1 RNA binding region and a candidate anchoring transmembrane domain. It is coordinately regulated with oestrogen receptor, but is not necessarily oestradiol-responsive. TTC39B has been linked to lipid metabolism.


Pssm-ID: 463047 [Multi-domain]  Cd Length: 469  Bit Score: 71.61  E-value: 2.99e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 663070941    1 MMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEkgPENEYSVDDECLVKLLKGLCLKYL 59
Cdd:pfam10300 413 LIYFWNGFSRMGKKPLLTESVLKLIEKALKANP--TSEAQEPDDKCLKQLLKGLCLRHL 469
 
Name Accession Description Interval E-value
Iml2-TPR_39 pfam10300
Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to ...
 1-59 2.99e-15

Iml2/Tetratricopeptide repeat protein 39; This is a family of proteins conserved from fungi to humans, including fungal Inclusion body clearance protein Iml2 protein, animal tetratricopeptide repeat protein 39A/B/C (TT39A/B/C) and some uncharacterized proteins. Members of this family carry a tetratricopeptide repeat pfam07719 at their C terminus. This entry includes Iml2 and its paralogue-YKR018C from S. cerevisiae; Iml2 localizes to the cytoplasm and nucleus, and its expression is increased in response to DNA replication stress. It is found to be involved in lipid droplet-mediated inclusion body clearing after protein folding stress. In humans, TTC39A (also known as DEME6) is expressed in primary breast carcinomas but not in normal breast tissue, and has a putative eukaryotic RNP-1 RNA binding region and a candidate anchoring transmembrane domain. It is coordinately regulated with oestrogen receptor, but is not necessarily oestradiol-responsive. TTC39B has been linked to lipid metabolism.


Pssm-ID: 463047 [Multi-domain]  Cd Length: 469  Bit Score: 71.61  E-value: 2.99e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 663070941    1 MMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEkgPENEYSVDDECLVKLLKGLCLKYL 59
Cdd:pfam10300 413 LIYFWNGFSRMGKKPLLTESVLKLIEKALKANP--TSEAQEPDDKCLKQLLKGLCLRHL 469
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH