NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1770966427|ref|NP_001362562|]
View 

CDC42 small effector protein 2 [Homo sapiens]

Protein Classification

CRIB domain-containing protein( domain architecture ID 10065191)

Cdc42/Rac-interactive binding (CRIB) domain-containing protein which binds Cdc42p- and/or Rho-like small GTPases; similar to human CDC42 small effector protein 2 and Saccharomyces cerevisiae GTPase-interacting component 1 (Gic1p) and Gic2p

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
CRIB cd00132
PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; ...
 27-67 1.33e-10

PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. CRIB-containing effector proteins are functionally diverse and include serine/threonine kinases, tyrosine kinases, actin-binding proteins, and adapter molecules.


:

Pssm-ID: 238077  Cd Length: 42  Bit Score: 51.29  E-value: 1.33e-10
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 1770966427 27 SMIGEPTNFVHTAHVGSGD-LFSGMNSVSSIQNQMQSKGGYG 67
Cdd:cd00132    1 MEISTPTDFKHISHVGWDGvGFDGANLPPDLQSLFQTAGISA 42
 
Name Accession Description Interval E-value
CRIB cd00132
PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; ...
 27-67 1.33e-10

PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. CRIB-containing effector proteins are functionally diverse and include serine/threonine kinases, tyrosine kinases, actin-binding proteins, and adapter molecules.


Pssm-ID: 238077  Cd Length: 42  Bit Score: 51.29  E-value: 1.33e-10
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 1770966427 27 SMIGEPTNFVHTAHVGSGD-LFSGMNSVSSIQNQMQSKGGYG 67
Cdd:cd00132    1 MEISTPTDFKHISHVGWDGvGFDGANLPPDLQSLFQTAGISA 42
PBD pfam00786
P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also ...
 28-42 4.31e-04

P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).


Pssm-ID: 395634  Cd Length: 59  Bit Score: 34.98  E-value: 4.31e-04
                         10
                 ....*....|....*
gi 1770966427 28 MIGEPTNFVHTAHVG 42
Cdd:pfam00786  1 MISAPTNFKHTVHVG 15
PBD smart00285
P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also ...
 29-50 8.67e-03

P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).


Pssm-ID: 197628  Cd Length: 36  Bit Score: 31.02  E-value: 8.67e-03
                          10        20
                  ....*....|....*....|....*
gi 1770966427  29 IGEPTNFVHTAHVGS---GDLFSGM 50
Cdd:smart00285  1 ISTPTNFKHIAHVGFdgqTGGFTGL 25
 
Name Accession Description Interval E-value
CRIB cd00132
PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; ...
 27-67 1.33e-10

PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. CRIB-containing effector proteins are functionally diverse and include serine/threonine kinases, tyrosine kinases, actin-binding proteins, and adapter molecules.


Pssm-ID: 238077  Cd Length: 42  Bit Score: 51.29  E-value: 1.33e-10
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|..
gi 1770966427 27 SMIGEPTNFVHTAHVGSGD-LFSGMNSVSSIQNQMQSKGGYG 67
Cdd:cd00132    1 MEISTPTDFKHISHVGWDGvGFDGANLPPDLQSLFQTAGISA 42
PBD pfam00786
P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also ...
 28-42 4.31e-04

P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).


Pssm-ID: 395634  Cd Length: 59  Bit Score: 34.98  E-value: 4.31e-04
                         10
                 ....*....|....*
gi 1770966427 28 MIGEPTNFVHTAHVG 42
Cdd:pfam00786  1 MISAPTNFKHTVHVG 15
CRIB_PAK_like cd01093
PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; ...
 27-50 3.63e-03

PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. This subgroup of CRIB/PBD-domains is found N-terminal of Serine/Threonine kinase domains in PAK and PAK-like proteins.


Pssm-ID: 238526  Cd Length: 46  Bit Score: 32.24  E-value: 3.63e-03
                         10        20
                 ....*....|....*....|....*...
gi 1770966427 27 SMIGEPTNFVHTAHVG----SGDlFSGM 50
Cdd:cd01093    1 PEISSPTNFKHRVHVGfdpqTGE-FTGL 27
PBD smart00285
P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also ...
 29-50 8.67e-03

P21-Rho-binding domain; Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).


Pssm-ID: 197628  Cd Length: 36  Bit Score: 31.02  E-value: 8.67e-03
                          10        20
                  ....*....|....*....|....*
gi 1770966427  29 IGEPTNFVHTAHVGS---GDLFSGM 50
Cdd:smart00285  1 ISTPTNFKHIAHVGFdgqTGGFTGL 25
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH