Conserved Protein Domain Family
bCoV_NS7B

?
pfam11395: bCoV_NS7B 
Betacoronavirus NS7B protein
This entry corresponds to Human SARS coronavirus (SARS-CoV) and similar betacoronaviruses NS7B protein (also known as accessory protein 7b, NS7B, ORF7b and 7b). It was found to be a structural component of SARS-CoV virions and an integral membrane protein. Its transmembrane domain is essential for Golgi compartment localization.
Statistics
?
PSSM-Id: 431866
Aligned: 2 rows
Threshold Bit Score: 46.8464
Created: 24-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7TFA1  1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTK 43  Severe acute respiratory syndrome-related coronavirus
Q7TFA1  1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTK 43  Severe acute respiratory syndrome-related coronavirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap